Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51512
Gene name Gene Name - the full gene name approved by the HGNC.	G2 and S-phase expressed 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GTSE1
Synonyms (NCBI Gene) Gene synonyms aliases	B99
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.31
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor supp

Show/Hide all(96)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042290	hsa-miR-484	CLASH	23622248
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT613532	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT1038269	hsa-miR-122	CLIP-seq
MIRT1038270	hsa-miR-1224-3p	CLIP-seq
MIRT1038271	hsa-miR-1245b-5p	CLIP-seq
MIRT1038272	hsa-miR-1262	CLIP-seq
MIRT1038273	hsa-miR-1293	CLIP-seq
MIRT1038274	hsa-miR-1297	CLIP-seq
MIRT1038275	hsa-miR-150	CLIP-seq
MIRT1038276	hsa-miR-151-5p	CLIP-seq
MIRT1038277	hsa-miR-151b	CLIP-seq
MIRT1038278	hsa-miR-1973	CLIP-seq
MIRT1038279	hsa-miR-2114	CLIP-seq
MIRT1038280	hsa-miR-23a	CLIP-seq
MIRT1038281	hsa-miR-23b	CLIP-seq
MIRT1038282	hsa-miR-23c	CLIP-seq
MIRT1038283	hsa-miR-2467-3p	CLIP-seq
MIRT1038284	hsa-miR-2467-5p	CLIP-seq
MIRT1038285	hsa-miR-26a	CLIP-seq
MIRT1038286	hsa-miR-26b	CLIP-seq
MIRT1038287	hsa-miR-296-3p	CLIP-seq
MIRT1038288	hsa-miR-3123	CLIP-seq
MIRT1038289	hsa-miR-3135b	CLIP-seq
MIRT1038290	hsa-miR-3142	CLIP-seq
MIRT1038291	hsa-miR-3156-3p	CLIP-seq
MIRT1038292	hsa-miR-3157-5p	CLIP-seq
MIRT1038293	hsa-miR-3168	CLIP-seq
MIRT1038294	hsa-miR-3188	CLIP-seq
MIRT1038295	hsa-miR-3189-3p	CLIP-seq
MIRT1038296	hsa-miR-3199	CLIP-seq
MIRT1038297	hsa-miR-323-5p	CLIP-seq
MIRT1038298	hsa-miR-338-3p	CLIP-seq
MIRT1038299	hsa-miR-342-3p	CLIP-seq
MIRT1038300	hsa-miR-3652	CLIP-seq
MIRT1038301	hsa-miR-3919	CLIP-seq
MIRT1038302	hsa-miR-3925-3p	CLIP-seq
MIRT1038303	hsa-miR-3960	CLIP-seq
MIRT1038304	hsa-miR-3975	CLIP-seq
MIRT1038305	hsa-miR-4301	CLIP-seq
MIRT1038306	hsa-miR-4430	CLIP-seq
MIRT1038307	hsa-miR-4438	CLIP-seq
MIRT1038308	hsa-miR-4465	CLIP-seq
MIRT1038309	hsa-miR-4467	CLIP-seq
MIRT1038310	hsa-miR-4483	CLIP-seq
MIRT1038311	hsa-miR-4530	CLIP-seq
MIRT1038312	hsa-miR-4646-5p	CLIP-seq
MIRT1038313	hsa-miR-4649-3p	CLIP-seq
MIRT1038314	hsa-miR-4690-3p	CLIP-seq
MIRT1038315	hsa-miR-4701-3p	CLIP-seq
MIRT1038316	hsa-miR-4779	CLIP-seq
MIRT1038317	hsa-miR-485-5p	CLIP-seq
MIRT1038318	hsa-miR-491-3p	CLIP-seq
MIRT1038319	hsa-miR-5095	CLIP-seq
MIRT1038320	hsa-miR-562	CLIP-seq
MIRT1038321	hsa-miR-766	CLIP-seq
MIRT1038322	hsa-miR-885-3p	CLIP-seq
MIRT1038269	hsa-miR-122	CLIP-seq
MIRT1038289	hsa-miR-3135b	CLIP-seq
MIRT1038300	hsa-miR-3652	CLIP-seq
MIRT1038306	hsa-miR-4430	CLIP-seq
MIRT2007836	hsa-miR-4705	CLIP-seq
MIRT2240494	hsa-miR-140-3p	CLIP-seq
MIRT1038275	hsa-miR-150	CLIP-seq
MIRT1038280	hsa-miR-23a	CLIP-seq
MIRT1038281	hsa-miR-23b	CLIP-seq
MIRT1038282	hsa-miR-23c	CLIP-seq
MIRT2240495	hsa-miR-3149	CLIP-seq
MIRT1038291	hsa-miR-3156-3p	CLIP-seq
MIRT1038292	hsa-miR-3157-5p	CLIP-seq
MIRT1038296	hsa-miR-3199	CLIP-seq
MIRT1038305	hsa-miR-4301	CLIP-seq
MIRT1038307	hsa-miR-4438	CLIP-seq
MIRT1038314	hsa-miR-4690-3p	CLIP-seq
MIRT1038319	hsa-miR-5095	CLIP-seq
MIRT2240496	hsa-miR-532-3p	CLIP-seq
MIRT1038320	hsa-miR-562	CLIP-seq
MIRT2240494	hsa-miR-140-3p	CLIP-seq
MIRT1038296	hsa-miR-3199	CLIP-seq
MIRT1038307	hsa-miR-4438	CLIP-seq
MIRT1038319	hsa-miR-5095	CLIP-seq
MIRT2450892	hsa-miR-941	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005515	Function	Protein binding	IPI	20577264
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005881	Component	Cytoplasmic microtubule	IBA	21873635
GO:0005881	Component	Cytoplasmic microtubule	IDA	10974554
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	NAS	10974554
GO:0007017	Process	Microtubule-based process	NAS	10974554
GO:0008017	Function	Microtubule binding	IBA	21873635
GO:0015630	Component	Microtubule cytoskeleton	IBA	21873635
GO:0016020	Component	Membrane	HDA	19946888
GO:0030335	Process	Positive regulation of cell migration	TAS
GO:0046827	Process	Positive regulation of protein export from nucleus	TAS
GO:0050821	Process	Protein stabilization	TAS
GO:1900182	Process	Positive regulation of protein localization to nucleus	TAS
GO:1902749	Process	Regulation of cell cycle G2/M phase transition	TAS

MIM	HGNC	e!Ensembl
607477	13698	ENSG00000075218

Protein

UniProt ID

Q9NYZ3

Protein name

G2 and S phase-expressed protein 1 (GTSE-1) (Protein B99 homolog)

Protein function

May be involved in p53-induced cell cycle arrest in G2/M phase by interfering with microtubule rearrangements that are required to enter mitosis. Overexpression delays G2/M phase progression.

PDB

6QNN , 6QNP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15259	GTSE1_N	9 → 152	G-2 and S-phase expressed 1	Family

Sequence

MDDPKKEDILLLADEKFDFDLSLSSSSANEDDEVFFGPFGHKERCIAASLELNNPVPEQP
PLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAAQAAKPEDPRSQGVERFIQ
ESKLKINLFEKEKEMKKSPTSLKRETYYLSDSPLLGPPVGEPRLLASSPALPSSGAQARL
TRAPGPPHSAHALPRESCTAHAASQAATQRKPGTKLLLPRAASVRGRSIPGAAEKPKKEI
PASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQGKRAIPVPNKLGLKKTLLKA
PGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSEFASIPANSSRPLSNISKSGRMGPA
MLRPALPAGPVGASSWQAKRVDVSELAAEQLTAPPSASPTQPQTPEGGGQWLNSSCAWSE
SSQLNKTRSIRRRDSCLNSKTKVMPTPTNQFKIPKFSIGDSPDSSTPKLSRAQRPQSCTS
VGRVTVHSTPVRRSSGPAPQSLLSAWRVSALPTPASRRCSGLPPMTPKTMPRAVGSPLCV
PARRRSSEPRKNSAMRTEPTRESNRKTDSRLVDVSPDRGSPPSRVPQALNFSPEESDSTF
SKSTATEVAREEAKPGGDAAPSEALLVDIKLEPLAVTPDAASQPLIDLPLIDFCDTPEAH
VAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF

Sequence length

720

Interactions

View interactions

	KEGG		Reactome
	p53 signaling pathway		G2/M Checkpoints The role of GTSE1 in G2/M progression after G2 checkpoint

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Stimulate	22292647, 26349752
Adenocarcinoma	Associate	34818353
Barrett Esophagus	Associate	34818353
Breast Neoplasms	Associate	23236459, 27485113, 32705365
Carcinoma Hepatocellular	Associate	28698581, 32082966, 33880590
Carcinoma Large Cell	Stimulate	26349752
Carcinoma Non Small Cell Lung	Associate	32202046
Carcinoma Non Small Cell Lung	Stimulate	37079439
Carcinoma Renal Cell	Associate	28260099
Carcinoma Renal Cell	Stimulate	35585131
Carcinoma Small Cell	Stimulate	26349752
Carcinoma Squamous Cell	Stimulate	22292647, 26349752
Chromosomal Instability	Stimulate	27881713
Ciliary Dyskinesia With Transposition Of Ciliary Microtubules	Associate	37079439
Dermatitis Atopic	Associate	36543921
Leiomyosarcoma	Associate	25748237
Lung Neoplasms	Stimulate	22292647
Lung Neoplasms	Associate	34007784
Lymphatic Metastasis	Associate	37079439
Neoplasm Metastasis	Associate	22485171, 23236459, 35585131
Neoplasm Metastasis	Stimulate	27485113
Neoplasms	Associate	27225591, 27881713, 28423514, 28698581, 32082966, 35585131, 37653815
Neoplasms	Stimulate	34007784
Neoplasms Basal Cell	Associate	25921176
Stomach Neoplasms	Associate	26209226
Urinary Bladder Neoplasms	Associate	25921176

GTSE1 (G2 and S-phase expressed 1)