Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51454
Gene name Gene Name - the full gene name approved by the HGNC.
GULP PTB domain containing engulfment adaptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GULP1
Synonyms (NCBI Gene) Gene synonyms aliases
CED-6, CED6, GULP
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q32.1-q32.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an adapter protein necessary for the engulfment of apoptotic cells by phagocytes. Several transcript variants, some protein coding and some thought not to be protein coding, have been found for this gene. [provided by R
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016998 hsa-miR-335-5p Microarray 18185580
MIRT024316 hsa-miR-215-5p Microarray 19074876
MIRT026204 hsa-miR-192-5p Microarray 19074876
MIRT527139 hsa-miR-1277-5p PAR-CLIP 22012620
MIRT527138 hsa-miR-5011-5p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0006869 Process Lipid transport IEA
GO:0006909 Process Phagocytosis IEA
GO:0006911 Process Phagocytosis, engulfment IDA 11729193
GO:0006911 Process Phagocytosis, engulfment TAS 10574763
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608165 18649 ENSG00000144366
Protein
UniProt ID Q9UBP9
Protein name PTB domain-containing engulfment adapter protein 1 (Cell death protein 6 homolog) (PTB domain adapter protein CED-6) (Protein GULP)
Protein function May function as an adapter protein. Required for efficient phagocytosis of apoptotic cells. Modulates cellular glycosphingolipid and cholesterol transport. May play a role in the internalization and endosomal trafficking of various LRP1 ligands,
PDB 6ITU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00640 PID 27 155 Phosphotyrosine interaction domain (PTB/PID) Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Detected in macrophages, pancreas, kidney, skeletal muscle, heart, colon, intestine, lung, placenta and ovary. {ECO:0000269|PubMed:10574763}.
Sequence
MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIK
KSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSES
NKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLES
GGKDVETRKQIAGLQKRIQDLETEN
MELKNKVQDLENQLRITQVSAPPAGSMTPKSPSTDIFDMIPFSPISHQSSMPTRNGTQPP
PVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPL
DSRC
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Efferocytosis  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Uterine Fibroids Uterine fibroids N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Emphysema Associate 28284325
Neoplasm Invasiveness Associate 34576193
Neoplasms Associate 40447753
Pancreatic Neoplasms Associate 40447753
Pulmonary Disease Chronic Obstructive Associate 22829758, 28284325
Urinary Bladder Neoplasms Associate 34576193