PRRX2 (paired related homeobox 2)

Gene
Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51450
Gene name Gene Name - the full gene name approved by the HGNC.
Paired related homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRRX2
Synonyms (NCBI Gene) Gene synonyms aliases
PMX2, PRX2
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.11
Summary Summary of gene provided in NCBI Entrez Gene.
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in ex
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(17)
miRTarBase ID miRNA Experiments Reference
MIRT023165 hsa-miR-124-3p Microarray 18668037
MIRT738996 hsa-miR-296-3p CLIP-seq
MIRT738995 hsa-miR-4265 CLIP-seq
MIRT738994 hsa-miR-4296 CLIP-seq
MIRT738993 hsa-miR-4322 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003700 Function DNA-binding transcription factor activity NAS 11063257
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
604675 21338 ENSG00000167157
Protein
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Q99811
Protein name Paired mesoderm homeobox protein 2 (Paired-related homeobox protein 2) (PRX-2)
Protein function May play a role in the scarless healing of cutaneous wounds during the first two trimesters of development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 105 → 161 Homeodomain Domain
PF03826 OAR 226 → 244 OAR motif Motif
Tissue specificity TISSUE SPECIFICITY: In fetal skin, highest expression found in cells of mesodermal origin within the dermal papilla of the developing hair shaft. Not detected in epidermis or dermis. In adult skin, weakly expressed within the basal layers of the epidermis
Sequence 
MDSAAAAFALDKPALGPGPPPPPPALGPGDCAQARKNFSVSHLLDLEEVAAAGRLAARPG
ARAEAREGAAREPSGGSSGSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQALE
RVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQ
EAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAK
EFSLHHSQVPTVN
Sequence length 253
Interactions View interactions