PRRX2 (paired related homeobox 2)

Gene

• Entrez ID: 51450
• Gene name: Paired related homeobox 2
• Gene symbol: PRRX2
• Synonyms (NCBI Gene): PMX2, PRX2
• Chromosome: 9
• Chromosome location: 9q34.11
• Summary: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in ex

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023165	hsa-miR-124-3p	Microarray	18668037
MIRT738996	hsa-miR-296-3p	CLIP-seq
MIRT738995	hsa-miR-4265	CLIP-seq
MIRT738994	hsa-miR-4296	CLIP-seq
MIRT738993	hsa-miR-4322	CLIP-seq
MIRT738992	hsa-miR-4417	CLIP-seq
MIRT738996	hsa-miR-296-3p	CLIP-seq
MIRT738995	hsa-miR-4265	CLIP-seq
MIRT738994	hsa-miR-4296	CLIP-seq
MIRT738993	hsa-miR-4322	CLIP-seq
MIRT738992	hsa-miR-4417	CLIP-seq
MIRT2078851	hsa-miR-374c	CLIP-seq
MIRT2078852	hsa-miR-4731-3p	CLIP-seq
MIRT2078853	hsa-miR-4801	CLIP-seq
MIRT2078854	hsa-miR-655	CLIP-seq
MIRT2078855	hsa-miR-659	CLIP-seq
MIRT2305121	hsa-miR-626	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	11063257
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	9665387
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 604675
• HGNC: 21338
• e!Ensembl: ENSG00000167157

Protein

• UniProt ID: Q99811
• Protein name: Paired mesoderm homeobox protein 2 (Paired-related homeobox protein 2) (PRX-2)
• Protein function: May play a role in the scarless healing of cutaneous wounds during the first two trimesters of development.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	105 → 161	Homeodomain	Domain
  PF03826	OAR	226 → 244	OAR motif	Motif

• Tissue specificity: TISSUE SPECIFICITY: In fetal skin, highest expression found in cells of mesodermal origin within the dermal papilla of the developing hair shaft. Not detected in epidermis or dermis. In adult skin, weakly expressed within the basal layers of the epidermis
• Sequence:

  MDSAAAAFALDKPALGPGPPPPPPALGPGDCAQARKNFSVSHLLDLEEVAAAGRLAARPG
  ARAEAREGAAREPSGGSSGSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQALE
  RVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQ
  EAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAK
  EFSLHHSQVPTVN

• Sequence length: 253

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Fuchs' Endothelial Dystrophy	Inhibit	18378575	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	36266731	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	35915143	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	35405009	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	28380430, 35405009	★☆☆☆☆ Found in Text Mining only