Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5134
Gene name Gene Name - the full gene name approved by the HGNC.	Programmed cell death 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PDCD2
Synonyms (NCBI Gene) Gene synonyms aliases	RP8, ZMYND7
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q27
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a nuclear protein expressed in a variety of tissues. Expression of this gene has been shown to be repressed by B-cell CLL/lymphoma 6 (BCL6), a transcriptional repressor required for lymph node germinal center development, suggesting that

Show/Hide all(56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054135	hsa-miR-129-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	25111461
MIRT054135	hsa-miR-129-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	25111461
MIRT054135	hsa-miR-129-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	25111461
MIRT054135	hsa-miR-129-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	25111461
MIRT1219276	hsa-miR-1197	CLIP-seq
MIRT1219277	hsa-miR-1305	CLIP-seq
MIRT1219278	hsa-miR-3143	CLIP-seq
MIRT1219279	hsa-miR-3658	CLIP-seq
MIRT1219280	hsa-miR-3922-5p	CLIP-seq
MIRT1219281	hsa-miR-4426	CLIP-seq
MIRT1219282	hsa-miR-4477a	CLIP-seq
MIRT1219283	hsa-miR-4647	CLIP-seq
MIRT1219284	hsa-miR-4662b	CLIP-seq
MIRT1219285	hsa-miR-498	CLIP-seq
MIRT1219286	hsa-miR-543	CLIP-seq
MIRT1219287	hsa-miR-3065-3p	CLIP-seq
MIRT1219288	hsa-miR-4662a-3p	CLIP-seq
MIRT1219289	hsa-miR-890	CLIP-seq
MIRT1219290	hsa-miR-369-3p	CLIP-seq
MIRT1219291	hsa-miR-374c	CLIP-seq
MIRT1219292	hsa-miR-411	CLIP-seq
MIRT1219293	hsa-miR-4727-5p	CLIP-seq
MIRT1219294	hsa-miR-4760-5p	CLIP-seq
MIRT1219295	hsa-miR-4775	CLIP-seq
MIRT1219296	hsa-miR-562	CLIP-seq
MIRT1219297	hsa-miR-590-3p	CLIP-seq
MIRT1219298	hsa-miR-655	CLIP-seq
MIRT1219299	hsa-miR-892a	CLIP-seq
MIRT2063412	hsa-miR-3614-3p	CLIP-seq
MIRT2063413	hsa-miR-4432	CLIP-seq
MIRT2063414	hsa-miR-499-5p	CLIP-seq
MIRT1219299	hsa-miR-892a	CLIP-seq
MIRT2456047	hsa-miR-3163	CLIP-seq
MIRT1219292	hsa-miR-411	CLIP-seq
MIRT2456048	hsa-miR-4275	CLIP-seq
MIRT2456049	hsa-miR-4480	CLIP-seq
MIRT2456050	hsa-miR-4662a-5p	CLIP-seq
MIRT2589543	hsa-miR-3616-5p	CLIP-seq
MIRT2589544	hsa-miR-362-5p	CLIP-seq
MIRT2589545	hsa-miR-3647-5p	CLIP-seq
MIRT2589546	hsa-miR-370	CLIP-seq
MIRT2589547	hsa-miR-3910	CLIP-seq
MIRT2589548	hsa-miR-4267	CLIP-seq
MIRT2589549	hsa-miR-4793-5p	CLIP-seq
MIRT2589550	hsa-miR-500b	CLIP-seq
MIRT2589551	hsa-miR-573	CLIP-seq
MIRT2589552	hsa-miR-640	CLIP-seq
MIRT2687293	hsa-miR-3619-3p	CLIP-seq
MIRT2687294	hsa-miR-4287	CLIP-seq
MIRT2687295	hsa-miR-4469	CLIP-seq
MIRT2687296	hsa-miR-4520b-3p	CLIP-seq
MIRT2687297	hsa-miR-4529-3p	CLIP-seq
MIRT2687298	hsa-miR-4535	CLIP-seq
MIRT2687299	hsa-miR-4685-3p	CLIP-seq
MIRT2687300	hsa-miR-4776-5p	CLIP-seq
MIRT2687301	hsa-miR-642a	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
BCL6	Repression	20605493
BCL6	Unknown	11854457;17468402

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	19146857, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	20605493
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0043065	Process	Positive regulation of apoptotic process	IDA	20605493
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	IMP	22922207
GO:1902035	Process	Positive regulation of hematopoietic stem cell proliferation	IMP	22922207

MIM	HGNC	e!Ensembl
600866	8762	ENSG00000071994

Protein

UniProt ID

Q16342

Protein name

Programmed cell death protein 2 (Zinc finger MYND domain-containing protein 7) (Zinc finger protein Rp-8)

Protein function

May be a DNA-binding protein with a regulatory function. May play an important role in cell death and/or in regulation of cell proliferation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01753	zf-MYND	135 → 172	MYND finger	Domain
PF04194	PDCD2_C	189 → 339	Programmed cell death protein 2, C-terminal putative domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSF
LLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPET
GESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDH
IIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGEALEEELDSMAKHESREDKI
FQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNY
LKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP

Sequence length

344

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Endogenous depression		19955554	ClinVar

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	37338518
Carcinoma Hepatocellular	Associate	30664177
Depressive Disorder	Stimulate	19955554
Drug Related Side Effects and Adverse Reactions	Associate	26191203
Fatigue Syndrome Chronic	Associate	16049284
Leukemia	Associate	22922207, 23760497
Leukemia Myeloid Acute	Associate	23760497
Neoplasm Metastasis	Inhibit	30664177
Neoplasms	Associate	23760497, 30664177

PDCD2 (programmed cell death 2)