Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	5134
Gene name	Programmed cell death 2
Gene symbol	PDCD2
Synonyms (NCBI Gene)	RP8ZMYND7
Chromosome	6
Chromosome location	6q27
Summary	This gene encodes a nuclear protein expressed in a variety of tissues. Expression of this gene has been shown to be repressed by B-cell CLL/lymphoma 6 (BCL6), a transcriptional repressor required for lymph node germinal center development, suggesting that

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054135	hsa-miR-129-1-3p	Luciferase reporter assayqRT-PCRWestern blot	25111461
MIRT054135	hsa-miR-129-1-3p	Luciferase reporter assayqRT-PCRWestern blot	25111461
MIRT054135	hsa-miR-129-1-3p	Luciferase reporter assayqRT-PCRWestern blot	25111461
MIRT054135	hsa-miR-129-1-3p	Luciferase reporter assayqRT-PCRWestern blot	25111461
MIRT1219276	hsa-miR-1197	CLIP-seq
MIRT1219277	hsa-miR-1305	CLIP-seq
MIRT1219278	hsa-miR-3143	CLIP-seq
MIRT1219279	hsa-miR-3658	CLIP-seq
MIRT1219280	hsa-miR-3922-5p	CLIP-seq
MIRT1219281	hsa-miR-4426	CLIP-seq
MIRT1219282	hsa-miR-4477a	CLIP-seq
MIRT1219283	hsa-miR-4647	CLIP-seq
MIRT1219284	hsa-miR-4662b	CLIP-seq
MIRT1219285	hsa-miR-498	CLIP-seq
MIRT1219286	hsa-miR-543	CLIP-seq
MIRT1219287	hsa-miR-3065-3p	CLIP-seq
MIRT1219288	hsa-miR-4662a-3p	CLIP-seq
MIRT1219289	hsa-miR-890	CLIP-seq
MIRT1219290	hsa-miR-369-3p	CLIP-seq
MIRT1219291	hsa-miR-374c	CLIP-seq
MIRT1219292	hsa-miR-411	CLIP-seq
MIRT1219293	hsa-miR-4727-5p	CLIP-seq
MIRT1219294	hsa-miR-4760-5p	CLIP-seq
MIRT1219295	hsa-miR-4775	CLIP-seq
MIRT1219296	hsa-miR-562	CLIP-seq
MIRT1219297	hsa-miR-590-3p	CLIP-seq
MIRT1219298	hsa-miR-655	CLIP-seq
MIRT1219299	hsa-miR-892a	CLIP-seq
MIRT2063412	hsa-miR-3614-3p	CLIP-seq
MIRT2063413	hsa-miR-4432	CLIP-seq
MIRT2063414	hsa-miR-499-5p	CLIP-seq
MIRT1219299	hsa-miR-892a	CLIP-seq
MIRT2456047	hsa-miR-3163	CLIP-seq
MIRT1219292	hsa-miR-411	CLIP-seq
MIRT2456048	hsa-miR-4275	CLIP-seq
MIRT2456049	hsa-miR-4480	CLIP-seq
MIRT2456050	hsa-miR-4662a-5p	CLIP-seq
MIRT2589543	hsa-miR-3616-5p	CLIP-seq
MIRT2589544	hsa-miR-362-5p	CLIP-seq
MIRT2589545	hsa-miR-3647-5p	CLIP-seq
MIRT2589546	hsa-miR-370	CLIP-seq
MIRT2589547	hsa-miR-3910	CLIP-seq
MIRT2589548	hsa-miR-4267	CLIP-seq
MIRT2589549	hsa-miR-4793-5p	CLIP-seq
MIRT2589550	hsa-miR-500b	CLIP-seq
MIRT2589551	hsa-miR-573	CLIP-seq
MIRT2589552	hsa-miR-640	CLIP-seq
MIRT2687293	hsa-miR-3619-3p	CLIP-seq
MIRT2687294	hsa-miR-4287	CLIP-seq
MIRT2687295	hsa-miR-4469	CLIP-seq
MIRT2687296	hsa-miR-4520b-3p	CLIP-seq
MIRT2687297	hsa-miR-4529-3p	CLIP-seq
MIRT2687298	hsa-miR-4535	CLIP-seq
MIRT2687299	hsa-miR-4685-3p	CLIP-seq
MIRT2687300	hsa-miR-4776-5p	CLIP-seq
MIRT2687301	hsa-miR-642a	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
BCL6	Repression	20605493
BCL6	Unknown	11854457;17468402

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	19146857, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	7606924
GO:0008270	Function	Zinc ion binding	IEA
GO:0012501	Process	Programmed cell death	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0043065	Process	Positive regulation of apoptotic process	IDA	20605493
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	IMP	22922207
GO:1902035	Process	Positive regulation of hematopoietic stem cell proliferation	IMP	22922207

MIM	HGNC	e!Ensembl
600866	8762	ENSG00000071994

Q16342

Protein name

Programmed cell death protein 2 (Zinc finger MYND domain-containing protein 7) (Zinc finger protein Rp-8)

Protein function

May be a DNA-binding protein with a regulatory function. May play an important role in cell death and/or in regulation of cell proliferation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01753	zf-MYND	135 → 172	MYND finger	Domain
PF04194	PDCD2_C	189 → 339	Programmed cell death protein 2, C-terminal putative domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSF
LLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPET
GESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDH
IIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGEALEEELDSMAKHESREDKI
FQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPDCPCGAKRILEFQVMPQLLNY
LKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP

Sequence length

344

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ENDOGENOUS DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	37338518	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	30664177	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Stimulate	19955554	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	26191203	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Associate	16049284	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	22922207, 23760497	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	23760497	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	30664177	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23760497, 30664177	★★★★★ ★☆☆☆☆ Found in Text Mining only

PDCD2 (programmed cell death 2)