Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51324
Gene name Gene Name - the full gene name approved by the HGNC.
SPG21 abhydrolase domain containing, maspardin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPG21
Synonyms (NCBI Gene) Gene synonyms aliases
ABHD21, ACP33, BM-019, GL010, MAST
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q22.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs369957508 G>A Pathogenic Coding sequence variant, stop gained
rs387906275 ->T Pathogenic Coding sequence variant, frameshift variant
rs587777315 C>G,T Pathogenic Coding sequence variant, missense variant
rs1332886505 ->C Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1383801 hsa-miR-1270 CLIP-seq
MIRT1383802 hsa-miR-1284 CLIP-seq
MIRT1383803 hsa-miR-1910 CLIP-seq
MIRT1383804 hsa-miR-300 CLIP-seq
MIRT1383805 hsa-miR-329 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 21516116, 22458338, 25416956, 25910212, 28514442, 31515488, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005768 Component Endosome IEA
GO:0005794 Component Golgi apparatus IEA
GO:0005829 Component Cytosol IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608181 20373 ENSG00000090487
Protein
UniProt ID Q9NZD8
Protein name Maspardin (Acid cluster protein 33) (Spastic paraplegia 21 autosomal recessive Mast syndrome protein) (Spastic paraplegia 21 protein)
Protein function May play a role as a negative regulatory factor in CD4-dependent T-cell activation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00561 Abhydrolase_1 39 171 alpha/beta hydrolase fold Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Expressed in J.CaM1.6, HuT 78 and HeLa cell lines (at protein level). {ECO:0000269|PubMed:11113139}.
Sequence
MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFF
RQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAE
YTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSG
PVDPMMADA
IDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYK
LYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGS
LGISQEEQ
Sequence length 308
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Endocytosis  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hereditary spastic paraplegia Hereditary spastic paraplegia rs755390093, rs387906275 N/A
MAST SYNDROME mast syndrome rs1332886505, rs755390093, rs387906275, rs587777315, rs369957508 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Dementia Associate 14564668
Mast Cell Activation Disorders Associate 14564668, 34492745
Neoplasms Associate 36609218
Paraplegia Associate 14564668
Peripheral Nervous System Diseases Associate 26556829
Spastic Paraplegia Hereditary Associate 14564668, 26556829
Thyroid Carcinoma Anaplastic Associate 36609218
Thyroid Neoplasms Associate 36609218