Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51311
Gene name Gene Name - the full gene name approved by the HGNC.
Toll like receptor 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TLR8
Synonyms (NCBI Gene) Gene synonyms aliases
CD288, IMD98, TLR-8, hTLR8
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp22.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT650804 hsa-miR-627-3p HITS-CLIP 23824327
MIRT650803 hsa-miR-891b HITS-CLIP 23824327
MIRT650804 hsa-miR-627-3p HITS-CLIP 23824327
MIRT650803 hsa-miR-891b HITS-CLIP 23824327
MIRT735683 hsa-miR-340-3p Immunofluorescence 31940779
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0002224 Process Toll-like receptor signaling pathway IBA
GO:0002376 Process Immune system process IEA
GO:0003677 Function DNA binding IDA 16123302
GO:0003723 Function RNA binding TAS 16123302
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300366 15632 ENSG00000101916
Protein
UniProt ID Q9NR97
Protein name Toll-like receptor 8 (CD antigen CD288)
Protein function Endosomal receptor that plays a key role in innate and adaptive immunity (PubMed:25297876, PubMed:32433612). Controls host immune response against pathogens through recognition of RNA degradation products specific to microorganisms that are init
PDB 3W3G , 3W3J , 3W3K , 3W3L , 3W3M , 3W3N , 3WN4 , 4QBZ , 4QC0 , 4R07 , 4R08 , 4R09 , 4R0A , 4R6A , 5AWA , 5AWB , 5AWC , 5AWD , 5AZ5 , 5HDH , 5WYX , 5WYZ , 5Z14 , 5Z15 , 6KYA , 6TY5 , 6V9U , 6WML , 6ZJZ , 7CRF , 7R52 , 7R53 , 7R54 , 7RC9 , 7YTX , 8PFI , 9MHW , 9MHX , 9MHY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00560 LRR_1 65 86 Leucine Rich Repeat Repeat
PF13855 LRR_8 276 323 Leucine rich repeat Repeat
PF13855 LRR_8 639 700 Leucine rich repeat Repeat
PF13855 LRR_8 712 774 Leucine rich repeat Repeat
PF01582 TIR 879 1039 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in myeloid dendritic cells, monocytes, and monocyte-derived dendritic cells. {ECO:0000269|PubMed:33718825}.
Sequence
MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQT
VGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGA
FLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWN
CYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEE
DFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR
KINAAWFKNMPHLKVLDLEFNYL
VGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINIS
RNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNL
EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCA
AYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNN
RLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT
DKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFL
NLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKL
LFLTDSLSDFTSSLRTLLLS
HNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPF
ECTCDI
GDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT
MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE
LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAF
YLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRN
VVLTENDSRYNNMYVDSIK
QY
Sequence length 1041
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Neutrophil extracellular trap formation
Toll-like receptor signaling pathway
Coronavirus disease - COVID-19
  Trafficking and processing of endosomal TLR
Toll Like Receptor 7/8 (TLR7/8) Cascade
TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
MyD88 dependent cascade initiated on endosome
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Celiac disease Celiac disease N/A N/A GWAS
Immunodeficiency immunodeficiency 98 with autoinflammation, X-linked N/A N/A GenCC
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Achondroplasia and Swiss type agammaglobulinemia Associate 17932028
Adenocarcinoma of Lung Associate 30521597, 32087603, 37746997
Alzheimer Disease Associate 17652175
Anemia Hemolytic Autoimmune Associate 34981838
Appendicitis Associate 24336024
Arthritis Associate 34981838, 36262248
Arthritis Juvenile Associate 28935693
Arthritis Rheumatoid Associate 16052591, 22730373, 31376255, 36262248
Arthritis Rheumatoid Stimulate 31501466, 33377396
Asthma Associate 26725554, 29486764, 32513781