Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51280
Gene name Gene Name - the full gene name approved by the HGNC.
Golgi membrane protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GOLM1
Synonyms (NCBI Gene) Gene synonyms aliases
C9orf155, GOLPH2, GP73, HEL46, PSEC0257, bA379P1.3
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q21.33
Summary Summary of gene provided in NCBI Entrez Gene.
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic r
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021516 hsa-miR-145-5p Reporter assay;Microarray 21351259
MIRT049838 hsa-miR-92a-3p CLASH 23622248
MIRT044582 hsa-miR-320a CLASH 23622248
MIRT041817 hsa-miR-484 CLASH 23622248
MIRT037078 hsa-miR-877-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21280149, 27569582, 32296183
GO:0005615 Component Extracellular space HDA 16502470
GO:0005788 Component Endoplasmic reticulum lumen TAS
GO:0005794 Component Golgi apparatus IDA
GO:0005887 Component Integral component of plasma membrane TAS 10831838
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606804 15451 ENSG00000135052
Protein
UniProt ID Q8NBJ4
Protein name Golgi membrane protein 1 (Golgi membrane protein GP73) (Golgi phosphoprotein 2)
Protein function Unknown. Cellular response protein to viral infection.
PDB 8YBC
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Express
Sequence
MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAER
GAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVL
QDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKK
GNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSS
EVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTP
QVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAES
ETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Sequence length 401
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung adenocarcinoma Adenocarcinoma of lung (disorder) rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370
View all (5 more)
27602772
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 26461057
Adenocarcinoma of Lung Stimulate 29843532
Barrett Esophagus Associate 26461057
Bile Duct Neoplasms Associate 19291786
Brachydactyly type C Stimulate 19291786
Breast Carcinoma In Situ Associate 25601220
Breast Neoplasms Associate 37761960
Candidemia Associate 27376574
Carcinogenesis Associate 29843532
Carcinogenesis Stimulate 30677226