Gene Gene information from NCBI Gene database.
Entrez ID 51280
Gene name Golgi membrane protein 1
Gene symbol GOLM1
Synonyms (NCBI Gene)
C9orf155GOLPH2GP73HEL46PSEC0257bA379P1.3
Chromosome 9
Chromosome location 9q21.33
Summary The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic r
miRNA miRNA information provided by mirtarbase database.
263
miRTarBase ID miRNA Experiments Reference
MIRT021516 hsa-miR-145-5p Reporter assay;Microarray 21351259
MIRT049838 hsa-miR-92a-3p CLASH 23622248
MIRT044582 hsa-miR-320a CLASH 23622248
MIRT041817 hsa-miR-484 CLASH 23622248
MIRT037078 hsa-miR-877-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21280149, 27569582, 32296183, 33961781
GO:0005615 Component Extracellular space HDA 16502470
GO:0005788 Component Endoplasmic reticulum lumen TAS
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606804 15451 ENSG00000135052
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NBJ4
Protein name Golgi membrane protein 1 (Golgi membrane protein GP73) (Golgi phosphoprotein 2)
Protein function Unknown. Cellular response protein to viral infection.
PDB 8YBC
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Express
Sequence
MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAER
GAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVL
QDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKK
GNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSS
EVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTP
QVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAES
ETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Sequence length 401
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation