CKLF (chemokine like factor)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51192
Gene name Gene Name - the full gene name approved by the HGNC.
Chemokine like factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CKLF
Synonyms (NCBI Gene) Gene synonyms aliases
C32, CKLF1, CKLF2, CKLF3, CKLF4, HSPC224, UCK-1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q21
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded b
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT019431 hsa-miR-148b-3p Microarray 17612493
MIRT024446 hsa-miR-215-5p Microarray 19074876
MIRT026750 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IDA 11415443
GO:0005615 Component Extracellular space IEA
GO:0007165 Process Signal transduction IEA
GO:0008009 Function Chemokine activity IDA 11415443
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
616074 13253 ENSG00000217555
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9UBR5
Protein name Chemokine-like factor (C32)
Protein function May play an important role in inflammation and regeneration of skeletal muscle (PubMed:11415443). Essential for embryonic development (By similarity). ; [Isoform 1]: Has chemo
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1, isoform 2, isoform 3 and isoform 4 have highest expression levels in adult spleen, lung, testis, ovary, peripheral blood leukocyte, placenta, pancreas, and in fetal brain, skeletal muscle, thymus and heart. Lower expression
Sequence 
MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFI
LLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVC
CLADGALIYRKLLFNPSGPYQKKPVHEKKEVL
Sequence length 152
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 21926974
Show/Hide Text Mining Associations (19)
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Associate 32195671
Arthritis Psoriatic Stimulate 29066845
Carcinoma Hepatocellular Associate 32685988
CD59 Deficiency Associate 23983609
Colorectal Neoplasms Associate 27153559
Dermatitis Atopic Stimulate 23983609
Desmoid disease hereditary Associate 33444924
Drug Hypersensitivity Associate 23983609
Fatty Liver Alcoholic Associate 32685988
Lupus Nephritis Associate 32195671