CKLF (chemokine like factor)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 51192
Gene name Chemokine like factor
Gene symbol CKLF
Synonyms (NCBI Gene)
C32CKLF1CKLF2CKLF3CKLF4HSPC224UCK-1
Chromosome 16
Chromosome location 16q21
Summary The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded b
miRNA miRNA information provided by mirtarbase database.
3
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (3)
miRTarBase ID miRNA Experiments Reference
MIRT019431 hsa-miR-148b-3p Microarray 17612493
MIRT024446 hsa-miR-215-5p Microarray 19074876
MIRT026750 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IDA 11415443
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
616074 13253 ENSG00000217555
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBR5
Protein name Chemokine-like factor (C32)
Protein function May play an important role in inflammation and regeneration of skeletal muscle (PubMed:11415443). Essential for embryonic development (By similarity). ; [Isoform 1]: Has chemo
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1, isoform 2, isoform 3 and isoform 4 have highest expression levels in adult spleen, lung, testis, ovary, peripheral blood leukocyte, placenta, pancreas, and in fetal brain, skeletal muscle, thymus and heart. Lower expression
Sequence 
MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFI
LLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVC
CLADGALIYRKLLFNPSGPYQKKPVHEKKEVL
Sequence length 152
Interactions View interactions