Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51181
Gene name Gene Name - the full gene name approved by the HGNC.	Dicarbonyl and L-xylulose reductase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DCXR
Synonyms (NCBI Gene) Gene synonyms aliases	DCR, HCR2, HCRII, KIDCR, P34H, PNTSU, SDR20C1, XR
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the cellular osmoregulation in the proximal re

Show/Hide all(11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037386	hsa-miR-744-5p	CLASH	23622248
MIRT928393	hsa-miR-1255b	CLIP-seq
MIRT928394	hsa-miR-3622b-5p	CLIP-seq
MIRT928395	hsa-miR-3675-5p	CLIP-seq
MIRT928396	hsa-miR-4283	CLIP-seq
MIRT928397	hsa-miR-4304	CLIP-seq
MIRT928398	hsa-miR-4489	CLIP-seq
MIRT928393	hsa-miR-1255b	CLIP-seq
MIRT928394	hsa-miR-3622b-5p	CLIP-seq
MIRT928395	hsa-miR-3675-5p	CLIP-seq
MIRT928397	hsa-miR-4304	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005829	Component	Cytosol	IEA
GO:0005881	Component	Cytoplasmic microtubule	IDA	23264731
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IEA
GO:0005903	Component	Brush border	IEA
GO:0005997	Process	Xylulose metabolic process	IBA
GO:0005997	Process	Xylulose metabolic process	IDA	11882650
GO:0005997	Process	Xylulose metabolic process	IEA
GO:0005997	Process	Xylulose metabolic process	IEA
GO:0006006	Process	Glucose metabolic process	IBA
GO:0006006	Process	Glucose metabolic process	IDA	11882650
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006739	Process	NADP+ metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016614	Function	Oxidoreductase activity, acting on CH-OH group of donors	IEA
GO:0016655	Function	Oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	19442656
GO:0019640	Process	D-glucuronate catabolic process to D-xylulose 5-phosphate	IEA
GO:0042732	Process	D-xylose metabolic process	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 31515488, 32296183
GO:0050038	Function	L-xylulose reductase (NADPH) activity	IBA
GO:0050038	Function	L-xylulose reductase (NADPH) activity	IDA	11882650
GO:0050038	Function	L-xylulose reductase (NADPH) activity	IEA
GO:0050038	Function	L-xylulose reductase (NADPH) activity	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	19442656

MIM	HGNC	e!Ensembl
608347	18985	ENSG00000169738

Protein

UniProt ID

Q7Z4W1

Protein name

L-xylulose reductase (XR) (EC 1.1.1.10) (Carbonyl reductase II) (Dicarbonyl/L-xylulose reductase) (Kidney dicarbonyl reductase) (kiDCR) (Short chain dehydrogenase/reductase family 20C member 1) (Sperm surface protein P34H)

Protein function

Catalyzes the NADPH-dependent reduction of several pentoses, tetroses, trioses, alpha-dicarbonyl compounds and L-xylulose. Participates in the uronate cycle of glucose metabolism. May play a role in the water absorption and cellular osmoregulati

PDB

1PR9 , 1WNT , 3D3W

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13561	adh_short_C2	14 → 242		Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in kidney, liver and epididymis. In the epididymis, it is mainly expressed in the proximal and distal sections of the corpus region. Weakly or not expressed in brain, lung, heart, spleen and testis. {ECO:0000269|PubMed

Sequence

MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVD
LGDWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVAR
GLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPT
VVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG
FWAC

Sequence length

244

Interactions

View interactions

	KEGG		Reactome
	Pentose and glucuronate interconversions Metabolic pathways		Formation of xylulose-5-phosphate Essential pentosuria

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Pentosuria	pentosuria	N/A	N/A	GenCC

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	36077333
Carcinogenesis	Associate	16847567
Carcinoma Hepatocellular	Inhibit	16847567
Carcinoma Hepatocellular	Associate	27658779
Diabetes Mellitus	Associate	31217356
Infertility	Associate	24882558
Neoplasms	Inhibit	16847567
Nephrotic Syndrome	Inhibit	31217356
Pentosuria	Associate	22042873
Renal Insufficiency Chronic	Associate	31217356
Urinary Bladder Neoplasms	Associate	36562811

DCXR (dicarbonyl and L-xylulose reductase)