Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51147
Gene name Gene Name - the full gene name approved by the HGNC.	Inhibitor of growth family member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ING4
Synonyms (NCBI Gene) Gene synonyms aliases	my036, p29ING4
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its

Show/Hide all(136)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000448	hsa-miR-650	Luciferase reporter assay, qRT-PCR, Western blot	20381459
MIRT006028	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assay, qRT-PCR	21106054
MIRT017117	hsa-miR-335-5p	Microarray	18185580
MIRT000448	hsa-miR-650	FACS, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23991130
MIRT000448	hsa-miR-650	FACS, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23991130
MIRT737063	hsa-miR-18a-5p	Luciferase reporter assay, Immunofluorescence	31724220
MIRT1066296	hsa-miR-1913	CLIP-seq
MIRT1066297	hsa-miR-3190	CLIP-seq
MIRT1066298	hsa-miR-324-3p	CLIP-seq
MIRT1066299	hsa-miR-3673	CLIP-seq
MIRT1066300	hsa-miR-3691-3p	CLIP-seq
MIRT1066301	hsa-miR-4301	CLIP-seq
MIRT1066302	hsa-miR-4491	CLIP-seq
MIRT1066303	hsa-miR-4657	CLIP-seq
MIRT1066304	hsa-miR-4738-3p	CLIP-seq
MIRT1066305	hsa-miR-4764-5p	CLIP-seq
MIRT1066306	hsa-miR-548g	CLIP-seq
MIRT1066307	hsa-miR-7	CLIP-seq
MIRT1066308	hsa-miR-892a	CLIP-seq
MIRT2248345	hsa-miR-3120-3p	CLIP-seq
MIRT2248346	hsa-miR-3607-5p	CLIP-seq
MIRT2248347	hsa-miR-4310	CLIP-seq
MIRT2248348	hsa-miR-4666-5p	CLIP-seq
MIRT2551928	hsa-miR-1227	CLIP-seq
MIRT2551929	hsa-miR-1252	CLIP-seq
MIRT2551930	hsa-miR-125a-5p	CLIP-seq
MIRT2551931	hsa-miR-125b	CLIP-seq
MIRT2551932	hsa-miR-1296	CLIP-seq
MIRT2551933	hsa-miR-1470	CLIP-seq
MIRT2551934	hsa-miR-1910	CLIP-seq
MIRT2551935	hsa-miR-31	CLIP-seq
MIRT2248345	hsa-miR-3120-3p	CLIP-seq
MIRT2551936	hsa-miR-3125	CLIP-seq
MIRT2551937	hsa-miR-3127-3p	CLIP-seq
MIRT2551938	hsa-miR-3165	CLIP-seq
MIRT2551939	hsa-miR-3179	CLIP-seq
MIRT2551940	hsa-miR-3189-5p	CLIP-seq
MIRT2551941	hsa-miR-3202	CLIP-seq
MIRT2551942	hsa-miR-330-3p	CLIP-seq
MIRT2551943	hsa-miR-331-3p	CLIP-seq
MIRT2551944	hsa-miR-342-5p	CLIP-seq
MIRT2248346	hsa-miR-3607-5p	CLIP-seq
MIRT2551945	hsa-miR-3612	CLIP-seq
MIRT2551946	hsa-miR-361-3p	CLIP-seq
MIRT2551947	hsa-miR-3661	CLIP-seq
MIRT2551948	hsa-miR-3916	CLIP-seq
MIRT2551949	hsa-miR-3936	CLIP-seq
MIRT2248347	hsa-miR-4310	CLIP-seq
MIRT2551950	hsa-miR-4313	CLIP-seq
MIRT2551951	hsa-miR-4319	CLIP-seq
MIRT2551952	hsa-miR-4424	CLIP-seq
MIRT2551953	hsa-miR-4428	CLIP-seq
MIRT2551954	hsa-miR-4443	CLIP-seq
MIRT2551955	hsa-miR-4446-3p	CLIP-seq
MIRT2551956	hsa-miR-4456	CLIP-seq
MIRT2551957	hsa-miR-4469	CLIP-seq
MIRT2551958	hsa-miR-4476	CLIP-seq
MIRT2551959	hsa-miR-4512	CLIP-seq
MIRT2551960	hsa-miR-4640-5p	CLIP-seq
MIRT2551961	hsa-miR-4656	CLIP-seq
MIRT2551962	hsa-miR-4664-5p	CLIP-seq
MIRT2248348	hsa-miR-4666-5p	CLIP-seq
MIRT2551963	hsa-miR-4667-3p	CLIP-seq
MIRT2551964	hsa-miR-4671-5p	CLIP-seq
MIRT2551965	hsa-miR-4686	CLIP-seq
MIRT2551966	hsa-miR-4696	CLIP-seq
MIRT2551967	hsa-miR-4721	CLIP-seq
MIRT2551968	hsa-miR-4726-5p	CLIP-seq
MIRT2551969	hsa-miR-4732-3p	CLIP-seq
MIRT2551970	hsa-miR-4749-3p	CLIP-seq
MIRT2551971	hsa-miR-4758-3p	CLIP-seq
MIRT2551972	hsa-miR-4766-5p	CLIP-seq
MIRT2551973	hsa-miR-4802-5p	CLIP-seq
MIRT2551974	hsa-miR-483-3p	CLIP-seq
MIRT2551975	hsa-miR-520d-5p	CLIP-seq
MIRT2551976	hsa-miR-524-5p	CLIP-seq
MIRT2551977	hsa-miR-631	CLIP-seq
MIRT2551978	hsa-miR-642a	CLIP-seq
MIRT2551979	hsa-miR-670	CLIP-seq
MIRT2551928	hsa-miR-1227	CLIP-seq
MIRT2551930	hsa-miR-125a-5p	CLIP-seq
MIRT2551931	hsa-miR-125b	CLIP-seq
MIRT2551932	hsa-miR-1296	CLIP-seq
MIRT2551933	hsa-miR-1470	CLIP-seq
MIRT2551934	hsa-miR-1910	CLIP-seq
MIRT2551935	hsa-miR-31	CLIP-seq
MIRT2248345	hsa-miR-3120-3p	CLIP-seq
MIRT2551936	hsa-miR-3125	CLIP-seq
MIRT2551937	hsa-miR-3127-3p	CLIP-seq
MIRT2551938	hsa-miR-3165	CLIP-seq
MIRT2551939	hsa-miR-3179	CLIP-seq
MIRT2551940	hsa-miR-3189-5p	CLIP-seq
MIRT2551941	hsa-miR-3202	CLIP-seq
MIRT2551942	hsa-miR-330-3p	CLIP-seq
MIRT2551943	hsa-miR-331-3p	CLIP-seq
MIRT2551944	hsa-miR-342-5p	CLIP-seq
MIRT2248346	hsa-miR-3607-5p	CLIP-seq
MIRT2551945	hsa-miR-3612	CLIP-seq
MIRT2551946	hsa-miR-361-3p	CLIP-seq
MIRT2551947	hsa-miR-3661	CLIP-seq
MIRT2551948	hsa-miR-3916	CLIP-seq
MIRT2551949	hsa-miR-3936	CLIP-seq
MIRT2248347	hsa-miR-4310	CLIP-seq
MIRT2551950	hsa-miR-4313	CLIP-seq
MIRT2551951	hsa-miR-4319	CLIP-seq
MIRT2551952	hsa-miR-4424	CLIP-seq
MIRT2551953	hsa-miR-4428	CLIP-seq
MIRT2551954	hsa-miR-4443	CLIP-seq
MIRT2551956	hsa-miR-4456	CLIP-seq
MIRT2551957	hsa-miR-4469	CLIP-seq
MIRT2551958	hsa-miR-4476	CLIP-seq
MIRT2551959	hsa-miR-4512	CLIP-seq
MIRT2551960	hsa-miR-4640-5p	CLIP-seq
MIRT2551962	hsa-miR-4664-5p	CLIP-seq
MIRT2248348	hsa-miR-4666-5p	CLIP-seq
MIRT2551963	hsa-miR-4667-3p	CLIP-seq
MIRT2551964	hsa-miR-4671-5p	CLIP-seq
MIRT2551965	hsa-miR-4686	CLIP-seq
MIRT2551966	hsa-miR-4696	CLIP-seq
MIRT2551968	hsa-miR-4726-5p	CLIP-seq
MIRT2551969	hsa-miR-4732-3p	CLIP-seq
MIRT2551970	hsa-miR-4749-3p	CLIP-seq
MIRT2551971	hsa-miR-4758-3p	CLIP-seq
MIRT2551972	hsa-miR-4766-5p	CLIP-seq
MIRT2551973	hsa-miR-4802-5p	CLIP-seq
MIRT2551974	hsa-miR-483-3p	CLIP-seq
MIRT2551975	hsa-miR-520d-5p	CLIP-seq
MIRT2551976	hsa-miR-524-5p	CLIP-seq
MIRT2551977	hsa-miR-631	CLIP-seq
MIRT2551978	hsa-miR-642a	CLIP-seq
MIRT2551979	hsa-miR-670	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
RUNX3	Activation	17956589

Show/Hide all(39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000123	Component	Histone acetyltransferase complex	IDA	16387653
GO:0001558	Process	Regulation of cell growth	IDA	22144582
GO:0001558	Process	Regulation of cell growth	ISS
GO:0003713	Function	Transcription coactivator activity	IDA	16387653
GO:0005515	Function	Protein binding	IPI	12750254, 15029197, 17157298, 20211142, 23603392, 24981860, 25416956, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15029197
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	16387653
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	22144582
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006473	Process	Protein acetylation	IDA	12750254
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	12750254, 15251430
GO:0036408	Function	Histone H3K14 acetyltransferase activity	IDA	16387653
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043517	Process	Positive regulation of DNA damage response, signal transduction by p53 class mediator	IDA	15251430
GO:0043995	Function	Histone H4K5 acetyltransferase activity	IDA	16387653
GO:0043996	Function	Histone H4K8 acetyltransferase activity	IDA	16387653
GO:0043997	Function	Histone H4K12 acetyltransferase activity	IDA	16387653
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15029197
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045926	Process	Negative regulation of growth	IDA	12750254
GO:0046872	Function	Metal ion binding	IEA
GO:0046972	Function	Histone H4K16 acetyltransferase activity	IDA	16387653
GO:0051726	Process	Regulation of cell cycle	IDA	16387653
GO:0140002	Function	Histone H3K4me3 reader activity	IDA	16728974
GO:0140889	Process	DNA replication-dependent chromatin disassembly	IDA	16387653
GO:0140889	Process	DNA replication-dependent chromatin disassembly	IEA
GO:1902749	Process	Regulation of cell cycle G2/M phase transition	IDA	15251430
GO:2000278	Process	Regulation of DNA biosynthetic process	IDA	16387653

MIM	HGNC	e!Ensembl
608524	19423	ENSG00000111653

Protein

UniProt ID

Q9UNL4

Protein name

Inhibitor of growth protein 4 (p29ING4)

Protein function

Component of HBO1 complexes, which specifically mediate acetylation of histone H3 at 'Lys-14' (H3K14ac), and have reduced activity toward histone H4 (PubMed:16387653). Through chromatin acetylation it may function in DNA replication (PubMed:1638

PDB

2K1J , 2M1R , 2PNX , 2VNF , 4AFL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12998	ING	6 → 107	Inhibitor of growth proteins N-terminal histone-binding	Coiled-coil

Sequence

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEE
KLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSD
YDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGS
VHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCP
RCSQERKKK

Sequence length

249

Interactions

View interactions

	Reactome
			HATs acetylate histones

ING4 (inhibitor of growth family member 4)