Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51147
Gene name	Inhibitor of growth family member 4
Gene symbol	ING4
Synonyms (NCBI Gene)	my036p29ING4
Chromosome	12
Chromosome location	12p13.31
Summary	This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its

136

Show/Hide all (136)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000448	hsa-miR-650	Luciferase reporter assayqRT-PCRWestern blot	20381459
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT006028	hsa-miR-214-3p	Luciferase reporter assayqRT-PCR	21106054
MIRT017117	hsa-miR-335-5p	Microarray	18185580
MIRT000448	hsa-miR-650	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23991130
MIRT000448	hsa-miR-650	FACSImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23991130
MIRT737063	hsa-miR-18a-5p	Luciferase reporter assayImmunofluorescence	31724220
MIRT1066296	hsa-miR-1913	CLIP-seq
MIRT1066297	hsa-miR-3190	CLIP-seq
MIRT1066298	hsa-miR-324-3p	CLIP-seq
MIRT1066299	hsa-miR-3673	CLIP-seq
MIRT1066300	hsa-miR-3691-3p	CLIP-seq
MIRT1066301	hsa-miR-4301	CLIP-seq
MIRT1066302	hsa-miR-4491	CLIP-seq
MIRT1066303	hsa-miR-4657	CLIP-seq
MIRT1066304	hsa-miR-4738-3p	CLIP-seq
MIRT1066305	hsa-miR-4764-5p	CLIP-seq
MIRT1066306	hsa-miR-548g	CLIP-seq
MIRT1066307	hsa-miR-7	CLIP-seq
MIRT1066308	hsa-miR-892a	CLIP-seq
MIRT2248345	hsa-miR-3120-3p	CLIP-seq
MIRT2248346	hsa-miR-3607-5p	CLIP-seq
MIRT2248347	hsa-miR-4310	CLIP-seq
MIRT2248348	hsa-miR-4666-5p	CLIP-seq
MIRT2551928	hsa-miR-1227	CLIP-seq
MIRT2551929	hsa-miR-1252	CLIP-seq
MIRT2551930	hsa-miR-125a-5p	CLIP-seq
MIRT2551931	hsa-miR-125b	CLIP-seq
MIRT2551932	hsa-miR-1296	CLIP-seq
MIRT2551933	hsa-miR-1470	CLIP-seq
MIRT2551934	hsa-miR-1910	CLIP-seq
MIRT2551935	hsa-miR-31	CLIP-seq
MIRT2248345	hsa-miR-3120-3p	CLIP-seq
MIRT2551936	hsa-miR-3125	CLIP-seq
MIRT2551937	hsa-miR-3127-3p	CLIP-seq
MIRT2551938	hsa-miR-3165	CLIP-seq
MIRT2551939	hsa-miR-3179	CLIP-seq
MIRT2551940	hsa-miR-3189-5p	CLIP-seq
MIRT2551941	hsa-miR-3202	CLIP-seq
MIRT2551942	hsa-miR-330-3p	CLIP-seq
MIRT2551943	hsa-miR-331-3p	CLIP-seq
MIRT2551944	hsa-miR-342-5p	CLIP-seq
MIRT2248346	hsa-miR-3607-5p	CLIP-seq
MIRT2551945	hsa-miR-3612	CLIP-seq
MIRT2551946	hsa-miR-361-3p	CLIP-seq
MIRT2551947	hsa-miR-3661	CLIP-seq
MIRT2551948	hsa-miR-3916	CLIP-seq
MIRT2551949	hsa-miR-3936	CLIP-seq
MIRT2248347	hsa-miR-4310	CLIP-seq
MIRT2551950	hsa-miR-4313	CLIP-seq
MIRT2551951	hsa-miR-4319	CLIP-seq
MIRT2551952	hsa-miR-4424	CLIP-seq
MIRT2551953	hsa-miR-4428	CLIP-seq
MIRT2551954	hsa-miR-4443	CLIP-seq
MIRT2551955	hsa-miR-4446-3p	CLIP-seq
MIRT2551956	hsa-miR-4456	CLIP-seq
MIRT2551957	hsa-miR-4469	CLIP-seq
MIRT2551958	hsa-miR-4476	CLIP-seq
MIRT2551959	hsa-miR-4512	CLIP-seq
MIRT2551960	hsa-miR-4640-5p	CLIP-seq
MIRT2551961	hsa-miR-4656	CLIP-seq
MIRT2551962	hsa-miR-4664-5p	CLIP-seq
MIRT2248348	hsa-miR-4666-5p	CLIP-seq
MIRT2551963	hsa-miR-4667-3p	CLIP-seq
MIRT2551964	hsa-miR-4671-5p	CLIP-seq
MIRT2551965	hsa-miR-4686	CLIP-seq
MIRT2551966	hsa-miR-4696	CLIP-seq
MIRT2551967	hsa-miR-4721	CLIP-seq
MIRT2551968	hsa-miR-4726-5p	CLIP-seq
MIRT2551969	hsa-miR-4732-3p	CLIP-seq
MIRT2551970	hsa-miR-4749-3p	CLIP-seq
MIRT2551971	hsa-miR-4758-3p	CLIP-seq
MIRT2551972	hsa-miR-4766-5p	CLIP-seq
MIRT2551973	hsa-miR-4802-5p	CLIP-seq
MIRT2551974	hsa-miR-483-3p	CLIP-seq
MIRT2551975	hsa-miR-520d-5p	CLIP-seq
MIRT2551976	hsa-miR-524-5p	CLIP-seq
MIRT2551977	hsa-miR-631	CLIP-seq
MIRT2551978	hsa-miR-642a	CLIP-seq
MIRT2551979	hsa-miR-670	CLIP-seq
MIRT2551928	hsa-miR-1227	CLIP-seq
MIRT2551930	hsa-miR-125a-5p	CLIP-seq
MIRT2551931	hsa-miR-125b	CLIP-seq
MIRT2551932	hsa-miR-1296	CLIP-seq
MIRT2551933	hsa-miR-1470	CLIP-seq
MIRT2551934	hsa-miR-1910	CLIP-seq
MIRT2551935	hsa-miR-31	CLIP-seq
MIRT2248345	hsa-miR-3120-3p	CLIP-seq
MIRT2551936	hsa-miR-3125	CLIP-seq
MIRT2551937	hsa-miR-3127-3p	CLIP-seq
MIRT2551938	hsa-miR-3165	CLIP-seq
MIRT2551939	hsa-miR-3179	CLIP-seq
MIRT2551940	hsa-miR-3189-5p	CLIP-seq
MIRT2551941	hsa-miR-3202	CLIP-seq
MIRT2551942	hsa-miR-330-3p	CLIP-seq
MIRT2551943	hsa-miR-331-3p	CLIP-seq
MIRT2551944	hsa-miR-342-5p	CLIP-seq
MIRT2248346	hsa-miR-3607-5p	CLIP-seq
MIRT2551945	hsa-miR-3612	CLIP-seq
MIRT2551946	hsa-miR-361-3p	CLIP-seq
MIRT2551947	hsa-miR-3661	CLIP-seq
MIRT2551948	hsa-miR-3916	CLIP-seq
MIRT2551949	hsa-miR-3936	CLIP-seq
MIRT2248347	hsa-miR-4310	CLIP-seq
MIRT2551950	hsa-miR-4313	CLIP-seq
MIRT2551951	hsa-miR-4319	CLIP-seq
MIRT2551952	hsa-miR-4424	CLIP-seq
MIRT2551953	hsa-miR-4428	CLIP-seq
MIRT2551954	hsa-miR-4443	CLIP-seq
MIRT2551956	hsa-miR-4456	CLIP-seq
MIRT2551957	hsa-miR-4469	CLIP-seq
MIRT2551958	hsa-miR-4476	CLIP-seq
MIRT2551959	hsa-miR-4512	CLIP-seq
MIRT2551960	hsa-miR-4640-5p	CLIP-seq
MIRT2551962	hsa-miR-4664-5p	CLIP-seq
MIRT2248348	hsa-miR-4666-5p	CLIP-seq
MIRT2551963	hsa-miR-4667-3p	CLIP-seq
MIRT2551964	hsa-miR-4671-5p	CLIP-seq
MIRT2551965	hsa-miR-4686	CLIP-seq
MIRT2551966	hsa-miR-4696	CLIP-seq
MIRT2551968	hsa-miR-4726-5p	CLIP-seq
MIRT2551969	hsa-miR-4732-3p	CLIP-seq
MIRT2551970	hsa-miR-4749-3p	CLIP-seq
MIRT2551971	hsa-miR-4758-3p	CLIP-seq
MIRT2551972	hsa-miR-4766-5p	CLIP-seq
MIRT2551973	hsa-miR-4802-5p	CLIP-seq
MIRT2551974	hsa-miR-483-3p	CLIP-seq
MIRT2551975	hsa-miR-520d-5p	CLIP-seq
MIRT2551976	hsa-miR-524-5p	CLIP-seq
MIRT2551977	hsa-miR-631	CLIP-seq
MIRT2551978	hsa-miR-642a	CLIP-seq
MIRT2551979	hsa-miR-670	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RUNX3	Activation	17956589

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000123	Component	Histone acetyltransferase complex	IDA	16387653
GO:0001558	Process	Regulation of cell growth	IDA	22144582
GO:0001558	Process	Regulation of cell growth	ISS
GO:0003713	Function	Transcription coactivator activity	IDA	16387653
GO:0005515	Function	Protein binding	IPI	12750254, 15029197, 17157298, 20211142, 23603392, 24981860, 25416956, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15029197
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	16387653
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	22144582
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006473	Process	Protein acetylation	IDA	12750254
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	12750254, 15251430
GO:0036408	Function	Histone H3K14 acetyltransferase activity	IDA	16387653
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043517	Process	Positive regulation of DNA damage response, signal transduction by p53 class mediator	IDA	15251430
GO:0043995	Function	Histone H4K5 acetyltransferase activity	IDA	16387653
GO:0043996	Function	Histone H4K8 acetyltransferase activity	IDA	16387653
GO:0043997	Function	Histone H4K12 acetyltransferase activity	IDA	16387653
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15029197
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045926	Process	Negative regulation of growth	IDA	12750254
GO:0046872	Function	Metal ion binding	IEA
GO:0046972	Function	Histone H4K16 acetyltransferase activity	IDA	16387653
GO:0051726	Process	Regulation of cell cycle	IDA	16387653
GO:0140002	Function	Histone H3K4me3 reader activity	IDA	16728974
GO:0140889	Process	DNA replication-dependent chromatin disassembly	IDA	16387653
GO:0140889	Process	DNA replication-dependent chromatin disassembly	IEA
GO:1902749	Process	Regulation of cell cycle G2/M phase transition	IDA	15251430
GO:2000278	Process	Regulation of DNA biosynthetic process	IDA	16387653

MIM	HGNC	e!Ensembl
608524	19423	ENSG00000111653

Q9UNL4

Protein name

Inhibitor of growth protein 4 (p29ING4)

Protein function

Component of HBO1 complexes, which specifically mediate acetylation of histone H3 at 'Lys-14' (H3K14ac), and have reduced activity toward histone H4 (PubMed:16387653). Through chromatin acetylation it may function in DNA replication (PubMed:1638

PDB

2K1J , 2M1R , 2PNX , 2VNF , 4AFL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12998	ING	6 → 107	Inhibitor of growth proteins N-terminal histone-binding	Coiled-coil

Sequence

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEE
KLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSD
YDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGS
VHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCP
RCSQERKKK

Sequence length

249

Interactions

View interactions

	Reactome
			HATs acetylate histones

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Prostate cancer	Uncertain significance	rs193921122	RCV000149055

Show/Hide Text Mining Associations (41)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Inhibit	18399550
Adenocarcinoma of Lung	Associate	22460125
Adenoma	Inhibit	21626442
Astrocytoma	Inhibit	19775294
Brain Neoplasms	Inhibit	23684856
Breast Neoplasms	Inhibit	20716169, 21315418
Breast Neoplasms	Associate	23056468, 25792601, 34871062
Carcinogenesis	Associate	16973615, 23967213
Carcinoma Hepatocellular	Associate	27421660
Carcinoma Non Small Cell Lung	Associate	26278569
Carcinoma Non Small Cell Lung	Inhibit	37870169
Colorectal Neoplasms	Inhibit	21626442, 23055189
Dysplastic Nevus Syndrome	Associate	23028750
Epstein Barr Virus Infections	Associate	21177815
Glioblastoma	Inhibit	17363573
Glioma	Associate	19479822
Glioma	Inhibit	20716169, 23684856
Leukemia Prolymphocytic T Cell	Associate	29516674
Leukocyte adhesion deficiency type 1	Associate	23991130
Lung Neoplasms	Inhibit	20716169
Lymphatic Metastasis	Inhibit	20716169, 21626442, 23055189
Melanoma	Associate	23028750, 24157826
Mitochondrial Diseases	Stimulate	23684856
Multiple Myeloma	Associate	17848618
Nasopharyngeal Carcinoma	Associate	27421660
Neoplasm Metastasis	Inhibit	17363573
Neoplasm Metastasis	Associate	25792601, 27466989, 30052810
Neoplasms	Inhibit	15897452, 16973615, 17363573, 17848618, 18399550, 19479822, 19775294, 20716169, 21454715, 23055189, 23603392, 23967213, 27349517, 27421660, 34871062
Neoplasms	Associate	18779315, 21177815, 21315418, 22460125, 25490312, 25792601, 28101578
Odontogenic Tumors	Associate	34787253
Osteosarcoma	Associate	25490312
Ovarian Neoplasms	Associate	27349517
Pancreatic Neoplasms	Associate	34268979
Prostatic Neoplasms	Associate	27527891
Prostatitis	Inhibit	27527891
Sarcoidosis	Associate	23181555
Squamous Cell Carcinoma of Head and Neck	Inhibit	17363573
Squamous Cell Carcinoma of Head and Neck	Associate	19479822
Stomach Neoplasms	Associate	19479822, 20716169
Tertiary Lymphoid Structures	Inhibit	23056468
Uterine Cervical Neoplasms	Inhibit	27466989

ING4 (inhibitor of growth family member 4)