Gene Gene information from NCBI Gene database.
Entrez ID 51142
Gene name Coiled-coil-helix-coiled-coil-helix domain containing 2
Gene symbol CHCHD2
Synonyms (NCBI Gene)
C7orf17MIX17BMNRR1NS2TPPARK22
Chromosome 7
Chromosome location 7p11.2
Summary The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress,
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs750014782 C>T Pathogenic Intron variant
rs752169833 C>A,T Pathogenic Coding sequence variant, missense variant
rs864309650 G>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
108
miRTarBase ID miRNA Experiments Reference
MIRT049175 hsa-miR-92a-3p CLASH 23622248
MIRT046923 hsa-miR-221-3p CLASH 23622248
MIRT041949 hsa-miR-484 CLASH 23622248
MIRT036288 hsa-miR-1229-3p CLASH 23622248
MIRT036209 hsa-miR-320b CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17500595, 24955142, 25416956, 27499296, 30496485, 30530185, 31515488, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 23303788
GO:0005634 Component Nucleus IEA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616244 21645 ENSG00000106153
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y6H1
Protein name Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 (Aging-associated gene 10 protein) (HCV NS2 trans-regulated protein) (NS2TP)
Protein function Transcription factor. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen) (PubMed:23303788).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06747 CHCH 114 147 CHCH domain Domain
Sequence
MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMA
TTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQ
FLECAQNQGDIKLCEGFNEVLKQCRLA
NGLA
Sequence length 151
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
10
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Parkinson disease 22, autosomal dominant Pathogenic rs864309650, rs750014782 RCV000203229
RCV000203226
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Amelogenesis imperfecta Benign rs1562887957 RCV001089670
CHCHD2-related disorder Benign; Likely benign rs35957514, rs753881759, rs535568444, rs142444896 RCV003931277
RCV003963709
RCV003917258
RCV003955699
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 40649864
Adenocarcinoma of Lung Associate 35937942
Alcoholic Neuropathy Associate 32437855
Amyotrophic Lateral Sclerosis Associate 29121267, 29519717, 30084972, 32437855
Breast Neoplasms Associate 31046734
Carcinogenesis Associate 25625293
Carcinoma Ductal Associate 31046734
Carcinoma Ductal Breast Associate 31046734
Carcinoma Hepatocellular Associate 25625293
Carcinoma Non Small Cell Lung Associate 25784717