Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51142
Gene name Gene Name - the full gene name approved by the HGNC.
Coiled-coil-helix-coiled-coil-helix domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CHCHD2
Synonyms (NCBI Gene) Gene synonyms aliases
C7orf17, MIX17B, MNRR1, NS2TP, PARK22
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress,
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs750014782 C>T Pathogenic Intron variant
rs752169833 C>A,T Pathogenic Coding sequence variant, missense variant
rs864309650 G>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049175 hsa-miR-92a-3p CLASH 23622248
MIRT046923 hsa-miR-221-3p CLASH 23622248
MIRT041949 hsa-miR-484 CLASH 23622248
MIRT036288 hsa-miR-1229-3p CLASH 23622248
MIRT036209 hsa-miR-320b CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17500595, 24955142, 25416956, 27499296, 30496485, 30530185, 31515488, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 23303788
GO:0005634 Component Nucleus IEA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616244 21645 ENSG00000106153
Protein
UniProt ID Q9Y6H1
Protein name Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 (Aging-associated gene 10 protein) (HCV NS2 trans-regulated protein) (NS2TP)
Protein function Transcription factor. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen) (PubMed:23303788).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06747 CHCH 114 147 CHCH domain Domain
Sequence
MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMA
TTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQ
FLECAQNQGDIKLCEGFNEVLKQCRLA
NGLA
Sequence length 151
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Parkinson disease parkinson disease 22, autosomal dominant rs864309650, rs750014782 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Amelogenesis imperfecta amelogenesis imperfecta N/A N/A ClinVar
Dementia Dementia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 40649864
Adenocarcinoma of Lung Associate 35937942
Alcoholic Neuropathy Associate 32437855
Amyotrophic Lateral Sclerosis Associate 29121267, 29519717, 30084972, 32437855
Breast Neoplasms Associate 31046734
Carcinogenesis Associate 25625293
Carcinoma Ductal Associate 31046734
Carcinoma Ductal Breast Associate 31046734
Carcinoma Hepatocellular Associate 25625293
Carcinoma Non Small Cell Lung Associate 25784717