ANGPTL4 (angiopoietin like 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 51129
Gene name Angiopoietin like 4
Gene symbol ANGPTL4
Synonyms (NCBI Gene)
ARP4FIAFHARPHFARPNL2PGARTGQTLUNQ171pp1158
Chromosome 19
Chromosome location 19p13.2
Summary This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and
miRNA miRNA information provided by mirtarbase database.
75
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (75)
miRTarBase ID miRNA Experiments Reference
MIRT022740 hsa-miR-124-3p Microarray 18668037
MIRT023828 hsa-miR-1-3p Microarray 18668037
MIRT438920 hsa-miR-29b-3p Luciferase reporter assayqRT-PCR 23354167
MIRT438920 hsa-miR-29b-3p Luciferase reporter assayqRT-PCR 23354167
MIRT438920 hsa-miR-29b-3p Luciferase reporter assayqRT-PCR 23354167
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (5)
Transcription factor Regulation Reference
PPARA Activation 12099716;15190076
PPARD Repression 15190076
PPARG Activation 15190076
PPARG Unknown 14570927
SMAD3 Activation 24330518
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (36)
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001666 Process Response to hypoxia IEA
GO:0001666 Process Response to hypoxia NAS 12707035
GO:0004857 Function Enzyme inhibitor activity IBA
GO:0004857 Function Enzyme inhibitor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605910 16039 ENSG00000167772
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BY76
Protein name Angiopoietin-related protein 4 (Angiopoietin-like protein 4) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) [Cleaved into: ANGPTL4 N-terminal chain; ANGPTL4 C-terminal chain]
Protein function Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism (PubMed:19270337, PubMed:21398697, PubMed:27929370, PubMed:29899144). May also
PDB 6EUB , 6U0A , 6U1U , 6U73
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00147 Fibrinogen_C 184 → 400 Fibrinogen beta and gamma chains, C-terminal globular domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in blood plasma (at protein level) (PubMed:29899519). Detected in liver (PubMed:10698685). Detected in white fat tissue and placenta (PubMed:10866690). Expressed at high levels in the placenta, heart, liver, muscle, pancreas a
Sequence 
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAE
RTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLF
HKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSR
LHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRP
WEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAY
SLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLN
GQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
Sequence length 406
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  PPAR signaling pathway
Cholesterol metabolism 		  PPARA activates gene expression
Transcriptional regulation of white adipocyte differentiation
Assembly of active LPL and LIPC lipase complexes
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
10
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
ANGPTL4-related disorder Benign; Likely benign rs11672433, rs139991923, rs538554190, rs752209196, rs10404615, rs35571542, rs61512436, rs3183953 RCV003979366
RCV003941753
RCV003941451
RCV003949820
RCV003939336
RCV003917347
RCV003932181
RCV003935997
Plasma triglyceride level quantitative trait locus association rs587777517, rs116843064 RCV000128569
RCV000004977
Show/Hide Text Mining Associations (129)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31847905, 32019546, 34323652, 35833114, 36793937, 37938151
Adenocarcinoma Papillary Stimulate 20664963
Anemia Sickle Cell Associate 28832635
Anorexia Nervosa Inhibit 29695708
Aortic Aneurysm Abdominal Associate 29191809, 40008516
Arthritis Rheumatoid Associate 22866899, 25289668, 34876931
Ataxia Telangiectasia Stimulate 32410376
Atherosclerosis Associate 18940399
Bone Diseases Associate 27519972
Bone Resorption Associate 25289668