Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51129
Gene name Gene Name - the full gene name approved by the HGNC.
Angiopoietin like 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ANGPTL4
Synonyms (NCBI Gene) Gene synonyms aliases
ARP4, FIAF, HARP, HFARP, NL2, PGAR, TGQTL, UNQ171, pp1158
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022740 hsa-miR-124-3p Microarray 18668037
MIRT023828 hsa-miR-1-3p Microarray 18668037
MIRT438920 hsa-miR-29b-3p Luciferase reporter assay, qRT-PCR 23354167
MIRT438920 hsa-miR-29b-3p Luciferase reporter assay, qRT-PCR 23354167
MIRT438920 hsa-miR-29b-3p Luciferase reporter assay, qRT-PCR 23354167
Transcription factors
Transcription factor Regulation Reference
PPARA Activation 12099716;15190076
PPARD Repression 15190076
PPARG Activation 15190076
PPARG Unknown 14570927
SMAD3 Activation 24330518
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001666 Process Response to hypoxia NAS 12707035
GO:0004857 Function Enzyme inhibitor activity IBA 21873635
GO:0004857 Function Enzyme inhibitor activity ISS
GO:0005102 Function Signaling receptor binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605910 16039 ENSG00000167772
Protein
UniProt ID Q9BY76
Protein name Angiopoietin-related protein 4 (Angiopoietin-like protein 4) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) [Cleaved into: ANGPTL4 N-terminal chain; ANGPTL4 C-terminal chain]
Protein function Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism (PubMed:19270337, PubMed:21398697, PubMed:27929370, PubMed:29899144). May also
PDB 6EUB , 6U0A , 6U1U , 6U73
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00147 Fibrinogen_C 184 400 Fibrinogen beta and gamma chains, C-terminal globular domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in blood plasma (at protein level) (PubMed:29899519). Detected in liver (PubMed:10698685). Detected in white fat tissue and placenta (PubMed:10866690). Expressed at high levels in the placenta, heart, liver, muscle, pancreas a
Sequence
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAE
RTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLF
HKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSR
LHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRP
WEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAY
SLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLN
GQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPM
AAEAAS
Sequence length 406
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  PPAR signaling pathway
Cholesterol metabolism
  PPARA activates gene expression
Transcriptional regulation of white adipocyte differentiation
Assembly of active LPL and LIPC lipase complexes
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
21489049
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
21489049
Carcinoma Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 21489049
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 29212778, 27135400, 28714975
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Myocardial Infarction Myocardial Infarction GWAS
Hyperlipidemia Hyperlipidemia GWAS
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31847905, 32019546, 34323652, 35833114, 36793937, 37938151
Adenocarcinoma Papillary Stimulate 20664963
Anemia Sickle Cell Associate 28832635
Anorexia Nervosa Inhibit 29695708
Aortic Aneurysm Abdominal Associate 29191809, 40008516
Arthritis Rheumatoid Associate 22866899, 25289668, 34876931
Ataxia Telangiectasia Stimulate 32410376
Atherosclerosis Associate 18940399
Bone Diseases Associate 27519972
Bone Resorption Associate 25289668