Gene Gene information from NCBI Gene database.
Entrez ID 51043
Gene name Zinc finger and BTB domain containing 7B
Gene symbol ZBTB7B
Synonyms (NCBI Gene)
CKROXTHPOKZBTB15ZFP-67ZFP67ZNF857Bc-KROXhcKROXvGAF
Chromosome 1
Chromosome location 1q21.3
Summary This gene encodes a zinc finger-containing transcription factor that acts as a key regulator of lineage commitment of immature T-cell precursors. It is necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. It als
miRNA miRNA information provided by mirtarbase database.
544
miRTarBase ID miRNA Experiments Reference
MIRT018753 hsa-miR-335-5p Microarray 18185580
MIRT044285 hsa-miR-106b-5p CLASH 23622248
MIRT036479 hsa-miR-1226-3p CLASH 23622248
MIRT722444 hsa-miR-7108-3p HITS-CLIP 19536157
MIRT722443 hsa-miR-2276-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
58
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607646 18668 ENSG00000160685
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15156
Protein name Zinc finger and BTB domain-containing protein 7B (Krueppel-related zinc finger protein cKrox) (hcKrox) (T-helper-inducing POZ/Krueppel-like factor) (Zinc finger and BTB domain-containing protein 15) (Zinc finger protein 67 homolog) (Zfp-67) (Zinc finger p
Protein function Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Exerts distinct biological functions in the mammary epithelial cells and T cells in a tissue-specific manner. Necessary and sufficient for
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 24 145 BTB/POZ domain Domain
PF00096 zf-C2H2 374 396 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 430 451 Zinc finger, C2H2 type Domain
Sequence
MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFK
KLFTEGGGGAVMGAGGSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPA
VLQAARLLEIPCVIAACMEILQGSG
LEAPSPDEDDCERARQYLEAFATATASGVPNGEDS
PPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAG
RVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP
EELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGK
LPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPHCPARFLHSYDLKNH
MHLHTGDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAS
PAGLDLSNGHLDTFRLSLARFWEQSAPTGPPVSTPGPPDDDEEEGAPTTPQAEGAMESS
Sequence length 539
Interactions View interactions