Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5104
Gene name Gene Name - the full gene name approved by the HGNC.	Serpin family A member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SERPINA5
Synonyms (NCBI Gene) Gene synonyms aliases	PAI-3, PAI3, PCI, PCI-B, PLANH3, PROCI
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.13
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. This gene is one in a cluster of serpin genes located on the q arm of chromosome 14. This family member is a glycoprotein tha

Show/Hide all(184)

miRTarBase ID	miRNA	Experiments
MIRT1338610	hsa-miR-3120-3p	CLIP-seq
MIRT1338611	hsa-miR-362-5p	CLIP-seq
MIRT1338612	hsa-miR-451b	CLIP-seq
MIRT1338613	hsa-miR-500b	CLIP-seq
MIRT2100121	hsa-miR-377	CLIP-seq
MIRT2100122	hsa-miR-4646-3p	CLIP-seq
MIRT2325001	hsa-miR-2053	CLIP-seq
MIRT2325002	hsa-miR-4446-5p	CLIP-seq
MIRT2325003	hsa-miR-4494	CLIP-seq
MIRT2325004	hsa-miR-499a-5p	CLIP-seq
MIRT2325005	hsa-miR-569	CLIP-seq
MIRT2620519	hsa-miR-1248	CLIP-seq
MIRT2620520	hsa-miR-1285	CLIP-seq
MIRT2620521	hsa-miR-1286	CLIP-seq
MIRT2620522	hsa-miR-1291	CLIP-seq
MIRT2620523	hsa-miR-1343	CLIP-seq
MIRT2620524	hsa-miR-138	CLIP-seq
MIRT2620525	hsa-miR-1470	CLIP-seq
MIRT2620526	hsa-miR-1914	CLIP-seq
MIRT2620527	hsa-miR-203	CLIP-seq
MIRT2620528	hsa-miR-204	CLIP-seq
MIRT2620529	hsa-miR-211	CLIP-seq
MIRT2620530	hsa-miR-2115	CLIP-seq
MIRT2620531	hsa-miR-218	CLIP-seq
MIRT1338610	hsa-miR-3120-3p	CLIP-seq
MIRT2620532	hsa-miR-3160-3p	CLIP-seq
MIRT2620533	hsa-miR-3161	CLIP-seq
MIRT2620534	hsa-miR-3187-5p	CLIP-seq
MIRT2620535	hsa-miR-3189-5p	CLIP-seq
MIRT2620536	hsa-miR-328	CLIP-seq
MIRT2620537	hsa-miR-3545-3p	CLIP-seq
MIRT2620538	hsa-miR-3649	CLIP-seq
MIRT2620539	hsa-miR-3659	CLIP-seq
MIRT2620540	hsa-miR-3660	CLIP-seq
MIRT2620541	hsa-miR-3688-5p	CLIP-seq
MIRT2620542	hsa-miR-3918	CLIP-seq
MIRT2620543	hsa-miR-3942-3p	CLIP-seq
MIRT2620544	hsa-miR-3943	CLIP-seq
MIRT2620545	hsa-miR-3945	CLIP-seq
MIRT2620546	hsa-miR-4252	CLIP-seq
MIRT2620547	hsa-miR-4253	CLIP-seq
MIRT2620548	hsa-miR-4299	CLIP-seq
MIRT2620549	hsa-miR-4323	CLIP-seq
MIRT2620550	hsa-miR-4433	CLIP-seq
MIRT2620551	hsa-miR-4436b-5p	CLIP-seq
MIRT2325002	hsa-miR-4446-5p	CLIP-seq
MIRT2620552	hsa-miR-4456	CLIP-seq
MIRT2620553	hsa-miR-4459	CLIP-seq
MIRT2620554	hsa-miR-4461	CLIP-seq
MIRT2620555	hsa-miR-4474-3p	CLIP-seq
MIRT2620556	hsa-miR-4487	CLIP-seq
MIRT2325003	hsa-miR-4494	CLIP-seq
MIRT2620557	hsa-miR-450b-5p	CLIP-seq
MIRT1338612	hsa-miR-451b	CLIP-seq
MIRT2620558	hsa-miR-4526	CLIP-seq
MIRT2620559	hsa-miR-4535	CLIP-seq
MIRT2620560	hsa-miR-4645-3p	CLIP-seq
MIRT2620561	hsa-miR-4648	CLIP-seq
MIRT2620562	hsa-miR-4654	CLIP-seq
MIRT2620563	hsa-miR-4658	CLIP-seq
MIRT2620564	hsa-miR-4667-3p	CLIP-seq
MIRT2620565	hsa-miR-4722-5p	CLIP-seq
MIRT2620566	hsa-miR-4755-3p	CLIP-seq
MIRT2620567	hsa-miR-4755-5p	CLIP-seq
MIRT2620568	hsa-miR-4758-5p	CLIP-seq
MIRT2620569	hsa-miR-4768-3p	CLIP-seq
MIRT2620570	hsa-miR-4769-5p	CLIP-seq
MIRT2620571	hsa-miR-4776-5p	CLIP-seq
MIRT2620572	hsa-miR-4778-3p	CLIP-seq
MIRT2620573	hsa-miR-492	CLIP-seq
MIRT2620574	hsa-miR-494	CLIP-seq
MIRT2325004	hsa-miR-499a-5p	CLIP-seq
MIRT2620575	hsa-miR-516a-3p	CLIP-seq
MIRT2620576	hsa-miR-518a-5p	CLIP-seq
MIRT2620577	hsa-miR-527	CLIP-seq
MIRT2620578	hsa-miR-558	CLIP-seq
MIRT2620579	hsa-miR-574-5p	CLIP-seq
MIRT2620580	hsa-miR-595	CLIP-seq
MIRT2620581	hsa-miR-612	CLIP-seq
MIRT2620582	hsa-miR-623	CLIP-seq
MIRT2620583	hsa-miR-635	CLIP-seq
MIRT2620584	hsa-miR-636	CLIP-seq
MIRT2620585	hsa-miR-663b	CLIP-seq
MIRT2620519	hsa-miR-1248	CLIP-seq
MIRT2620520	hsa-miR-1285	CLIP-seq
MIRT2620521	hsa-miR-1286	CLIP-seq
MIRT2620522	hsa-miR-1291	CLIP-seq
MIRT2620523	hsa-miR-1343	CLIP-seq
MIRT2620524	hsa-miR-138	CLIP-seq
MIRT2620525	hsa-miR-1470	CLIP-seq
MIRT2620526	hsa-miR-1914	CLIP-seq
MIRT2690456	hsa-miR-198	CLIP-seq
MIRT2620527	hsa-miR-203	CLIP-seq
MIRT2620528	hsa-miR-204	CLIP-seq
MIRT2325001	hsa-miR-2053	CLIP-seq
MIRT2620529	hsa-miR-211	CLIP-seq
MIRT2620530	hsa-miR-2115	CLIP-seq
MIRT2620531	hsa-miR-218	CLIP-seq
MIRT1338610	hsa-miR-3120-3p	CLIP-seq
MIRT2690457	hsa-miR-3153	CLIP-seq
MIRT2620532	hsa-miR-3160-3p	CLIP-seq
MIRT2620533	hsa-miR-3161	CLIP-seq
MIRT2690458	hsa-miR-3183	CLIP-seq
MIRT2620534	hsa-miR-3187-5p	CLIP-seq
MIRT2620535	hsa-miR-3189-5p	CLIP-seq
MIRT2690459	hsa-miR-326	CLIP-seq
MIRT2620536	hsa-miR-328	CLIP-seq
MIRT2690460	hsa-miR-330-5p	CLIP-seq
MIRT2620537	hsa-miR-3545-3p	CLIP-seq
MIRT1338611	hsa-miR-362-5p	CLIP-seq
MIRT2620538	hsa-miR-3649	CLIP-seq
MIRT2620539	hsa-miR-3659	CLIP-seq
MIRT2620540	hsa-miR-3660	CLIP-seq
MIRT2690461	hsa-miR-3662	CLIP-seq
MIRT2620541	hsa-miR-3688-5p	CLIP-seq
MIRT2690462	hsa-miR-3692	CLIP-seq
MIRT2620542	hsa-miR-3918	CLIP-seq
MIRT2620543	hsa-miR-3942-3p	CLIP-seq
MIRT2620544	hsa-miR-3943	CLIP-seq
MIRT2620545	hsa-miR-3945	CLIP-seq
MIRT2620546	hsa-miR-4252	CLIP-seq
MIRT2620547	hsa-miR-4253	CLIP-seq
MIRT2690463	hsa-miR-4264	CLIP-seq
MIRT2620548	hsa-miR-4299	CLIP-seq
MIRT2690464	hsa-miR-4302	CLIP-seq
MIRT2620549	hsa-miR-4323	CLIP-seq
MIRT2620550	hsa-miR-4433	CLIP-seq
MIRT2620551	hsa-miR-4436b-5p	CLIP-seq
MIRT2325002	hsa-miR-4446-5p	CLIP-seq
MIRT2620552	hsa-miR-4456	CLIP-seq
MIRT2620553	hsa-miR-4459	CLIP-seq
MIRT2620554	hsa-miR-4461	CLIP-seq
MIRT2620555	hsa-miR-4474-3p	CLIP-seq
MIRT2620556	hsa-miR-4487	CLIP-seq
MIRT2325003	hsa-miR-4494	CLIP-seq
MIRT2620557	hsa-miR-450b-5p	CLIP-seq
MIRT1338612	hsa-miR-451b	CLIP-seq
MIRT2620558	hsa-miR-4526	CLIP-seq
MIRT2620559	hsa-miR-4535	CLIP-seq
MIRT2690465	hsa-miR-4640-5p	CLIP-seq
MIRT2620560	hsa-miR-4645-3p	CLIP-seq
MIRT2620561	hsa-miR-4648	CLIP-seq
MIRT2620562	hsa-miR-4654	CLIP-seq
MIRT2620563	hsa-miR-4658	CLIP-seq
MIRT2620564	hsa-miR-4667-3p	CLIP-seq
MIRT2690466	hsa-miR-4694-3p	CLIP-seq
MIRT2690467	hsa-miR-4695-3p	CLIP-seq
MIRT2690468	hsa-miR-4698	CLIP-seq
MIRT2690469	hsa-miR-4705	CLIP-seq
MIRT2620565	hsa-miR-4722-5p	CLIP-seq
MIRT2690470	hsa-miR-4723-3p	CLIP-seq
MIRT2690471	hsa-miR-4726-5p	CLIP-seq
MIRT2690472	hsa-miR-4738-3p	CLIP-seq
MIRT2620566	hsa-miR-4755-3p	CLIP-seq
MIRT2620567	hsa-miR-4755-5p	CLIP-seq
MIRT2620568	hsa-miR-4758-5p	CLIP-seq
MIRT2620569	hsa-miR-4768-3p	CLIP-seq
MIRT2620570	hsa-miR-4769-5p	CLIP-seq
MIRT2620571	hsa-miR-4776-5p	CLIP-seq
MIRT2620572	hsa-miR-4778-3p	CLIP-seq
MIRT2690473	hsa-miR-4782-5p	CLIP-seq
MIRT2690474	hsa-miR-4797-3p	CLIP-seq
MIRT2690475	hsa-miR-4797-5p	CLIP-seq
MIRT2620573	hsa-miR-492	CLIP-seq
MIRT2620574	hsa-miR-494	CLIP-seq
MIRT2325004	hsa-miR-499a-5p	CLIP-seq
MIRT1338613	hsa-miR-500b	CLIP-seq
MIRT2620575	hsa-miR-516a-3p	CLIP-seq
MIRT2620576	hsa-miR-518a-5p	CLIP-seq
MIRT2690476	hsa-miR-520a-5p	CLIP-seq
MIRT2690477	hsa-miR-522	CLIP-seq
MIRT2690478	hsa-miR-525-5p	CLIP-seq
MIRT2620577	hsa-miR-527	CLIP-seq
MIRT2620578	hsa-miR-558	CLIP-seq
MIRT2690479	hsa-miR-568	CLIP-seq
MIRT2325005	hsa-miR-569	CLIP-seq
MIRT2620579	hsa-miR-574-5p	CLIP-seq
MIRT2620580	hsa-miR-595	CLIP-seq
MIRT2620581	hsa-miR-612	CLIP-seq
MIRT2620582	hsa-miR-623	CLIP-seq
MIRT2620583	hsa-miR-635	CLIP-seq
MIRT2620584	hsa-miR-636	CLIP-seq
MIRT2690480	hsa-miR-643	CLIP-seq
MIRT2620585	hsa-miR-663b	CLIP-seq

Show/Hide all(39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IDA	11722589
GO:0002020	Function	Protease binding	IPI	1725227, 2844223, 3501295, 6323392, 7521127, 8665956, 9556620, 10340997, 14696115, 15853774
GO:0002080	Component	Acrosomal membrane	IDA	7521127, 9510955
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA	21873635
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	1725227, 2844223, 3501295, 6323392, 7521127, 8536714, 9510955, 9556620, 10340997, 15853774
GO:0005515	Function	Protein binding	IPI	7521127, 8665956
GO:0005539	Function	Glycosaminoglycan binding	TAS	8796266
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS	11120760
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	1725227, 8536714, 8665956, 10340997
GO:0006869	Process	Lipid transport	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	NAS	9510955
GO:0007596	Process	Blood coagulation	TAS
GO:0008201	Function	Heparin binding	TAS	11120760
GO:0009897	Component	External side of plasma membrane	IDA	9556620
GO:0010951	Process	Negative regulation of endopeptidase activity	IBA	21873635
GO:0016020	Component	Membrane	IDA	7521127
GO:0031091	Component	Platelet alpha granule	IDA	9556620
GO:0031094	Component	Platelet dense tubular network	IDA	9556620
GO:0031210	Function	Phosphatidylcholine binding	IDA	9556620
GO:0032190	Function	Acrosin binding	IPI	7521127
GO:0032991	Component	Protein-containing complex	IDA	7521127, 8665956
GO:0036024	Component	Protein C inhibitor-TMPRSS7 complex	IDA	15853774
GO:0036025	Component	Protein C inhibitor-TMPRSS11E complex	IDA	15328353
GO:0036026	Component	Protein C inhibitor-PLAT complex	IDA	10340997
GO:0036027	Component	Protein C inhibitor-PLAU complex	IDA	3501295, 8536714, 10340997
GO:0036028	Component	Protein C inhibitor-thrombin complex	IDA	6323392
GO:0036029	Component	Protein C inhibitor-KLK3 complex	IDA	1725227
GO:0036030	Component	Protein C inhibitor-plasma kallikrein complex	IDA	2844223, 8536714
GO:0051346	Process	Negative regulation of hydrolase activity	IMP	8665956
GO:0061107	Process	Seminal vesicle development	IEA
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	28327460
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070062	Component	Extracellular exosome	IDA	21557262
GO:0097181	Component	Protein C inhibitor-coagulation factor V complex	IDA	6323392
GO:0097182	Component	Protein C inhibitor-coagulation factor Xa complex	IDA	6323392
GO:0097183	Component	Protein C inhibitor-coagulation factor XI complex	IDA	2844223

MIM	HGNC	e!Ensembl
601841	8723	ENSG00000188488

Protein

UniProt ID

P05154

Protein name

Plasma serine protease inhibitor (Acrosomal serine protease inhibitor) (Plasminogen activator inhibitor 3) (PAI-3) (PAI3) (Protein C inhibitor) (PCI) (Serpin A5)

Protein function

Heparin-dependent serine protease inhibitor acting in body fluids and secretions. Inactivates serine proteases by binding irreversibly to their serine activation site. Involved in the regulation of intravascular and extravascular proteolytic act

PDB

1LQ8 , 2HI9 , 2OL2 , 3DY0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	43 → 406	Serpin (serine protease inhibitor)	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in the epithelium of seminal vesicles. Expressed in the proximal tubular epithelium of the kidney. Expressed in the superficial and more differentiated epidermal keratinocytes of the skin. Expressed in megakaryo

Sequence

MQLFLLLCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAA
PSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQ
PRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQT
KGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSRED
QYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLE
LYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGT
RAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP

Sequence length

406

Interactions

View interactions

	KEGG		Reactome
	Complement and coagulation cascades		Intrinsic Pathway of Fibrin Clot Formation Common Pathway of Fibrin Clot Formation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Cholestasis	Cholestasis	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	27989131

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	28270177
alpha 1 Antitrypsin Deficiency	Associate	7912884
Alzheimer Disease	Associate	33875655, 37327267
Blood Coagulation Disorders	Associate	23520464
Breast Neoplasms	Associate	12176977, 25287138
Carcinogenesis	Stimulate	36000536
Carcinoma Hepatocellular	Associate	10417615
Carcinoma Hepatocellular	Inhibit	24388360
Carcinoma Renal Cell	Associate	39348357
Critical Illness	Associate	28270177
Dental Plaque	Associate	35535576
Diffuse Neurofibrillary Tangles with Calcification	Associate	37327267
Dyskinesia Drug Induced	Associate	25982926
Eunuchism	Associate	35663320
Fatigue Syndrome Chronic	Associate	37179299
Heart Failure	Associate	25725476
Heart Failure	Stimulate	35945262
HIV Infections	Associate	24928035
Immunologic Deficiency Syndromes	Associate	23520464
Infertility	Associate	35663320
Infertility Male	Associate	31336797
Inflammation	Associate	23520464
Neoplasm Metastasis	Inhibit	21102419, 24388360
Neoplasms	Associate	12176977, 21986992, 25287138, 32942548
Neoplasms	Inhibit	21102419, 24388360
Neoplasms Cystic Mucinous and Serous	Inhibit	21102419
Nerve Degeneration	Associate	37327267
Ovarian Neoplasms	Associate	21102419, 24388360
Parkinson Disease	Associate	25982926
Plaque Atherosclerotic	Associate	17332248
Psychotic Disorders	Associate	25982926
Sarcopenia	Inhibit	38229116
Shock Septic	Associate	28270177
Stomach Neoplasms	Associate	36000536
Thyroid Cancer Papillary	Associate	23520464, 27207655, 34837923
Thyroid Cancer Papillary	Stimulate	23520464
Urinary Incontinence Stress	Associate	27193112, 30715578
Virilism	Associate	35663320

SERPINA5 (serpin family A member 5)