Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51021
Gene name Gene Name - the full gene name approved by the HGNC.
Mitochondrial ribosomal protein S16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MRPS16
Synonyms (NCBI Gene) Gene synonyms aliases
CGI-132, COXPD2, MRP-S16, RPMS16, S16mt, bS16m
Disease Acronyms (UniProt) Disease acronyms from UniProt database
COXPD2
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q22.2
Summary Summary of gene provided in NCBI Entrez Gene.
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029903 hsa-miR-26b-5p Microarray 19088304
MIRT048083 hsa-miR-197-3p CLASH 23622248
MIRT047902 hsa-miR-30c-5p CLASH 23622248
MIRT045285 hsa-miR-186-5p CLASH 23622248
MIRT037587 hsa-miR-744-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IBA 21873635
GO:0003735 Function Structural constituent of ribosome ISS 11402041
GO:0003735 Function Structural constituent of ribosome NAS 11279123
GO:0005515 Function Protein binding IPI 19945174
GO:0005739 Component Mitochondrion IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609204 14048 ENSG00000182180
Protein
UniProt ID Q9Y3D3
Protein name Small ribosomal subunit protein bS16m (28S ribosomal protein S16, mitochondrial) (MRP-S16) (S16mt)
PDB 3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00886 Ribosomal_S16 24 84 Ribosomal protein S16 Family
Sequence
MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNS
HGEKLVALNLDRIRHWIGCGAHLS
KPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLL
ASQKTDAEATDTEATET
Sequence length 137
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ribosome   Mitochondrial translation elongation
Mitochondrial translation termination
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Combined oxidative phosphorylation deficiency Combined Oxidative Phosphorylation Deficiency 2, Combined oxidative phosphorylation defect type 2 rs587776508, rs576462794, rs118203917, rs387906327, rs139430866, rs387906962, rs138119149, rs387907061, rs1562800908, rs397515421, rs397514598, rs397514610, rs397514611, rs397514612, rs201431517
View all (155 more)
25655951, 18539099, 15505824, 21169334
Hypotonia Neonatal Hypotonia rs141138948, rs397517172, rs869312824, rs1583169151
Unknown
Disease term Disease name Evidence References Source
Mitochondrial Diseases mitochondrial disease GenCC
Combined Oxidative Phosphorylation Deficiency combined oxidative phosphorylation defect type 2 GenCC
Associations from Text Mining
Disease Name Relationship Type References
Mitochondrial Diseases Associate 21169334
Ovarian Neoplasms Associate 33934540