Gene Gene information from NCBI Gene database.
Entrez ID 51021
Gene name Mitochondrial ribosomal protein S16
Gene symbol MRPS16
Synonyms (NCBI Gene)
CGI-132COXPD2MRP-S16RPMS16S16mtbS16m
Chromosome 10
Chromosome location 10q22.2
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
1044
miRTarBase ID miRNA Experiments Reference
MIRT029903 hsa-miR-26b-5p Microarray 19088304
MIRT048083 hsa-miR-197-3p CLASH 23622248
MIRT047902 hsa-miR-30c-5p CLASH 23622248
MIRT045285 hsa-miR-186-5p CLASH 23622248
MIRT037587 hsa-miR-744-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IBA
GO:0003735 Function Structural constituent of ribosome IEA
GO:0003735 Function Structural constituent of ribosome ISS 11402041
GO:0003735 Function Structural constituent of ribosome NAS 11279123
GO:0005515 Function Protein binding IPI 19945174
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609204 14048 ENSG00000182180
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y3D3
Protein name Small ribosomal subunit protein bS16m (28S ribosomal protein S16, mitochondrial) (MRP-S16) (S16mt)
PDB 3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00886 Ribosomal_S16 24 84 Ribosomal protein S16 Family
Sequence
MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNS
HGEKLVALNLDRIRHWIGCGAHLS
KPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLL
ASQKTDAEATDTEATET
Sequence length 137
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ribosome   Mitochondrial translation elongation
Mitochondrial translation termination
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
31
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia - rs2018198 RCV006039849
Cervical cancer Likely benign rs117301007 RCV005920912
Combined oxidative phosphorylation defect type 2 Uncertain significance; Conflicting classifications of pathogenicity rs104894168, rs142389124, rs202242186 RCV000001909
RCV003147841
RCV005396931
Combined oxidative phosphorylation deficiency Uncertain significance rs886047201, rs886047203, rs886047196, rs763591161, rs574159820, rs2018198, rs767465725, rs886047188, rs555061429 RCV000265428
RCV000292837
RCV000286875
RCV000289464
RCV000272975
RCV000331294
RCV000372896
RCV000345967
RCV000314683
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Mitochondrial Diseases Associate 21169334
Ovarian Neoplasms Associate 33934540