TAS2R14 (taste 2 receptor member 14)

Gene

• Entrez ID: 50840
• Gene name: Taste 2 receptor member 14
• Gene symbol: TAS2R14
• Synonyms (NCBI Gene): T2R14, TRB1
• Chromosome: 12
• Chromosome location: 12p13.2
• Summary: This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organiz

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	16720576, 20022913
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IC	16720576
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008527	Function	Taste receptor activity	IDA	16720576
GO:0008527	Function	Taste receptor activity	TAS	10761934
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IC	16720576, 20022913
GO:0016020	Component	Membrane	IEA
GO:0033038	Function	Bitter taste receptor activity	IBA
GO:0033038	Function	Bitter taste receptor activity	IDA	16720576, 20022913
GO:0033038	Function	Bitter taste receptor activity	IEA
GO:0050909	Process	Sensory perception of taste	IEA

Other IDs

• MIM: 604790
• HGNC: 14920
• e!Ensembl: ENSG00000212127

Protein

• UniProt ID: Q9NYV8
• Protein name: Taste receptor type 2 member 14 (T2R14) (Taste receptor family B member 1) (TRB1)
• Protein function: Gustducin-linked G-protein coupled receptor that plays a role in the perception of bitterness (PubMed:38600377, PubMed:38776963). The activity of this receptor stimulates GNAT3, activating the gustducin G-protein pathway (PubMed:38600377, PubMed
• PDB: 8RQL, 8VY7, 8VY9, 8XQL, 8XQN, 8XQO, 8XQP, 8XQR, 8XQS, 8XQT, 8YKY, 9IIW, 9IIX, 9IJ9, 9IJA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05296	TAS2R	1 → 299	Taste receptor protein (TAS2R)	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in cerebellum, pancreas, small intestine and thymus; also expressed in adipose, aorta, skin and tongue, but at significantly lower levels (PubMed:38600377). Expressed in subsets of taste receptor cells of the tongue an
• Sequence:

  MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVW
  LIFGSWCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFL
  YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIV
  LTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLY
  AIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRY
  MFKDGEPSGHKEFRESS

• Sequence length: 317

Pathways

KEGG:

Taste transduction

Reactome:

G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)