Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
50813
Gene name Gene Name - the full gene name approved by the HGNC.
COP9 signalosome subunit 7A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COPS7A
Synonyms (NCBI Gene) Gene synonyms aliases
CSN7, CSN7A, SGN7a
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a component of the COP9 signalosome, an evolutionarily conserved multi-subunit protease that regulates the activity of the ubiquitin conjugation pathway. Alternatively spliced transcript variants that encode the same protein have been de
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024503 hsa-miR-215-5p Microarray 19074876
MIRT026890 hsa-miR-192-5p Microarray 19074876
MIRT030594 hsa-miR-24-3p Microarray 19748357
MIRT048306 hsa-miR-107 CLASH 23622248
MIRT047795 hsa-miR-30d-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000338 Process Protein deneddylation IDA 19141280
GO:0005515 Function Protein binding IPI 20399188, 24421388, 25043011, 26496610, 28514442, 32911434, 33961781
GO:0005634 Component Nucleus IDA 24421388
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616009 16758 ENSG00000111652
Protein
UniProt ID Q9UBW8
Protein name COP9 signalosome complex subunit 7a (SGN7a) (Signalosome subunit 7a) (Dermal papilla-derived protein 10) (JAB1-containing signalosome subunit 7a)
Protein function Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the culli
PDB 4D10 , 4D18 , 4WSN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01399 PCI 52 155 PCI domain Domain
PF18392 CSN7a_helixI 166 215 COP9 signalosome complex subunit 7a helix I domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at high level in brain, heart and skeletal muscle. {ECO:0000269|PubMed:12020345}.
Sequence
MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDF
ASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEAL
ALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVD
YSIGRDIQRQDLSAIARTLQEWCVG
CEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVAN
LKKTIKVTTAAAAAATSQDPEQHLT
ELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
Sequence length 275
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    DNA Damage Recognition in GG-NER
Formation of TC-NER Pre-Incision Complex
Cargo recognition for clathrin-mediated endocytosis
Neddylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthenozoospermia Stimulate 36471356
Carcinoma Renal Cell Associate 36180558
Cardiomyopathy Dilated Associate 36042172
Mental Disorders Associate 27219343