Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	50801
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium two pore domain channel subfamily K member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCNK4
Synonyms (NCBI Gene) Gene synonyms aliases	FHEIG, K2p4.1, TRAAK, TRAAK1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the TWIK-related arachidonic acid-stimulated two pore potassium channel subfamily. The encoded protein homodimerizes and functions as an outwardly rectifying channel. This channel is regulated by polyunsaturated fatty acids,

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017249	hsa-miR-335-5p	Microarray	18185580
MIRT1081852	hsa-miR-1304	CLIP-seq
MIRT1081853	hsa-miR-1827	CLIP-seq

Show/Hide all(52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005267	Function	Potassium channel activity	IDA	22282805
GO:0005267	Function	Potassium channel activity	IEA
GO:0005267	Function	Potassium channel activity	TAS	10767409
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	22282805
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	10767409
GO:0007613	Process	Memory	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0015271	Function	Outward rectifier potassium channel activity	IBA
GO:0015271	Function	Outward rectifier potassium channel activity	IDA	26919430
GO:0016020	Component	Membrane	IEA
GO:0019228	Process	Neuronal action potential	IEA
GO:0019228	Process	Neuronal action potential	ISS
GO:0019233	Process	Sensory perception of pain	ISS
GO:0022841	Function	Potassium ion leak channel activity	IBA
GO:0022841	Function	Potassium ion leak channel activity	IDA	26919430
GO:0022841	Function	Potassium ion leak channel activity	IEA
GO:0030424	Component	Axon	IEA
GO:0033268	Component	Node of Ranvier	IEA
GO:0033268	Component	Node of Ranvier	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034705	Component	Potassium channel complex	IDA	22282805
GO:0042802	Function	Identical protein binding	IPI	22282805, 25471887
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050951	Process	Sensory perception of temperature stimulus	ISS
GO:0050976	Process	Detection of mechanical stimulus involved in sensory perception of touch	IEA
GO:0050976	Process	Detection of mechanical stimulus involved in sensory perception of touch	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IDA	22282805, 26919430
GO:0071398	Process	Cellular response to fatty acid	IDA	22282805
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071468	Process	Cellular response to acidic pH	IDA	26919430
GO:0071469	Process	Cellular response to alkaline pH	IEA
GO:0071469	Process	Cellular response to alkaline pH	ISS
GO:0071502	Process	Cellular response to temperature stimulus	IEA
GO:0071502	Process	Cellular response to temperature stimulus	ISS
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IDA	22282805
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0097604	Function	Temperature-gated cation channel activity	IEA
GO:0097604	Function	Temperature-gated cation channel activity	ISS
GO:0098782	Function	Mechanosensitive potassium channel activity	IDA	22282805, 38605031
GO:0098782	Function	Mechanosensitive potassium channel activity	IEA
GO:1904551	Process	Cellular response to arachidonate	IDA	26919430
GO:1990478	Process	Response to ultrasound	IDA	38605031

MIM	HGNC	e!Ensembl
605720	6279	ENSG00000182450

Protein

UniProt ID

Q9NYG8

Protein name

Potassium channel subfamily K member 4 (TWIK-related arachidonic acid-stimulated potassium channel protein) (TRAAK) (Two pore potassium channel KT4.1) (K2P4.1) (Two pore K(+) channel KT4.1)

Protein function

K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate.

PDB

3UM7 , 4I9W , 4RUE , 4RUF , 4WFE , 4WFF , 4WFG , 4WFH , 7LJ4 , 7LJ5 , 7LJA , 7LJB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07885	Ion_trans_2	65 → 144	Ion channel	Family
PF07885	Ion_trans_2	165 → 259	Ion channel	Family

Sequence

MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGL
LIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFC
IFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGC
LLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWIL
LGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKE
QPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCP
LPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV

Sequence length

393

Interactions

View interactions

	Reactome
			TWIK related potassium channel (TREK) Phase 4 - resting membrane potential

KCNK4 (potassium two pore domain channel subfamily K member 4)