Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	50632
Gene name Gene Name - the full gene name approved by the HGNC.	Calcyon neuron specific vesicular protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CALY
Synonyms (NCBI Gene) Gene synonyms aliases	DRD1IP, NSG3
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q26.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopami

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments
MIRT860007	hsa-miR-3135b	CLIP-seq
MIRT860008	hsa-miR-3652	CLIP-seq
MIRT860009	hsa-miR-4430	CLIP-seq
MIRT860010	hsa-miR-4492	CLIP-seq
MIRT860011	hsa-miR-4498	CLIP-seq
MIRT860012	hsa-miR-4508	CLIP-seq
MIRT860013	hsa-miR-4706	CLIP-seq
MIRT860014	hsa-miR-4734	CLIP-seq
MIRT860015	hsa-miR-4749-5p	CLIP-seq
MIRT860016	hsa-miR-604	CLIP-seq
MIRT860017	hsa-miR-744	CLIP-seq
MIRT860018	hsa-miR-762	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16595675
GO:0005768	Component	Endosome	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	14534309
GO:0007212	Process	Dopamine receptor signaling pathway	IEA
GO:0008089	Process	Anterograde axonal transport	IEA
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016197	Process	Endosomal transport	IBA	21873635
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	14534309, 16595675
GO:0032051	Function	Clathrin light chain binding	IBA	21873635
GO:0032051	Function	Clathrin light chain binding	IDA	16595675
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045807	Process	Positive regulation of endocytosis	IMP	16595675
GO:0048268	Process	Clathrin coat assembly	IBA	21873635
GO:0048268	Process	Clathrin coat assembly	IDA	16595675
GO:0098843	Component	Postsynaptic endocytic zone	IDA	16595675
GO:0098843	Component	Postsynaptic endocytic zone	IMP	16595675
GO:0098884	Process	Postsynaptic neurotransmitter receptor internalization	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1904115	Component	Axon cytoplasm	IEA
GO:1905445	Process	Positive regulation of clathrin coat assembly	IEA
GO:2001019	Process	Positive regulation of retrograde axon cargo transport	IEA

MIM	HGNC	e!Ensembl
604647	17938	ENSG00000130643

Protein

UniProt ID

Q9NYX4

Protein name

Neuron-specific vesicular protein calcyon

Protein function

Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06387	Calcyon	1 → 181	D1 dopamine receptor-interacting protein (calcyon)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the pyramidal cells of the prefrontal cortex, in hypothalamus and in caudate nucleus. No expression in spleen. Up-regulated in the prefrontal cortex of schizophrenic patients with nearly twice the levels of non-schizophren

Sequence

MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD
QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR
HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT
QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ

Sequence length

217

Interactions

View interactions

	KEGG
	Dopaminergic synapse

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Attention deficit hyperactivity disorder	Attention Deficit Disorder, Attention deficit hyperactivity disorder	rs786205019	30753204
Hypertension	Essential Hypertension	rs13306026	30753204
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	14755439, 15364041

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Astrocytoma	Associate	18670637
Bipolar Disorder	Associate	31279243

CALY (calcyon neuron specific vesicular protein)