Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	50632
Gene name Gene Name - the full gene name approved by the HGNC.	Calcyon neuron specific vesicular protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CALY
Synonyms (NCBI Gene) Gene synonyms aliases	DRD1IP, NSG3
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q26.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopami

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments
MIRT860007	hsa-miR-3135b	CLIP-seq
MIRT860008	hsa-miR-3652	CLIP-seq
MIRT860009	hsa-miR-4430	CLIP-seq
MIRT860010	hsa-miR-4492	CLIP-seq
MIRT860011	hsa-miR-4498	CLIP-seq
MIRT860012	hsa-miR-4508	CLIP-seq
MIRT860013	hsa-miR-4706	CLIP-seq
MIRT860014	hsa-miR-4734	CLIP-seq
MIRT860015	hsa-miR-4749-5p	CLIP-seq
MIRT860016	hsa-miR-604	CLIP-seq
MIRT860017	hsa-miR-744	CLIP-seq
MIRT860018	hsa-miR-762	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16595675
GO:0005768	Component	Endosome	IBA
GO:0005886	Component	Plasma membrane	IDA	14534309
GO:0005886	Component	Plasma membrane	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	IBA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	14534309, 16595675
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032051	Function	Clathrin light chain binding	IBA
GO:0032051	Function	Clathrin light chain binding	IDA	16595675
GO:0032051	Function	Clathrin light chain binding	IEA
GO:0045807	Process	Positive regulation of endocytosis	IMP	16595675
GO:0048268	Process	Clathrin coat assembly	IBA
GO:0048268	Process	Clathrin coat assembly	IDA	16595675
GO:0048268	Process	Clathrin coat assembly	IEA
GO:0098843	Component	Postsynaptic endocytic zone	IDA	16595675
GO:0098843	Component	Postsynaptic endocytic zone	IMP	16595675
GO:0098884	Process	Postsynaptic neurotransmitter receptor internalization	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
604647	17938	ENSG00000130643

Protein

UniProt ID

Q9NYX4

Protein name

Neuron-specific vesicular protein calcyon

Protein function

Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06387	Calcyon	1 → 181	D1 dopamine receptor-interacting protein (calcyon)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the pyramidal cells of the prefrontal cortex, in hypothalamus and in caudate nucleus. No expression in spleen. Up-regulated in the prefrontal cortex of schizophrenic patients with nearly twice the levels of non-schizophren

Sequence

MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD
QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR
HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT
QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ

Sequence length

217

Interactions

View interactions

	KEGG
	Dopaminergic synapse

CALY (calcyon neuron specific vesicular protein)