Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	50604
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 20
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL20
Synonyms (NCBI Gene) Gene synonyms aliases	IL-20, IL10D, ZCYTO10
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053417	hsa-miR-624-3p	Microarray	23807165
MIRT1064475	hsa-miR-103a	CLIP-seq
MIRT1064476	hsa-miR-107	CLIP-seq
MIRT1064477	hsa-miR-1183	CLIP-seq
MIRT1064478	hsa-miR-15a	CLIP-seq
MIRT1064479	hsa-miR-15b	CLIP-seq
MIRT1064480	hsa-miR-16	CLIP-seq
MIRT1064481	hsa-miR-195	CLIP-seq
MIRT1064482	hsa-miR-3163	CLIP-seq
MIRT1064483	hsa-miR-424	CLIP-seq
MIRT1064484	hsa-miR-4524	CLIP-seq
MIRT1064485	hsa-miR-4693-5p	CLIP-seq
MIRT1064486	hsa-miR-497	CLIP-seq
MIRT1064487	hsa-miR-503	CLIP-seq
MIRT1064488	hsa-miR-568	CLIP-seq
MIRT1064489	hsa-miR-646	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	22802649
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	11470428
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	TAS	11470428
GO:0045517	Function	Interleukin-20 receptor binding	IEA
GO:0045517	Function	Interleukin-20 receptor binding	TAS	11470428
GO:0045518	Function	Interleukin-22 receptor binding	IEA
GO:0045606	Process	Positive regulation of epidermal cell differentiation	TAS	11470428
GO:0045618	Process	Positive regulation of keratinocyte differentiation	TAS	11470428
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0050727	Process	Regulation of inflammatory response	TAS	11470428

MIM	HGNC	e!Ensembl
605619	6002	ENSG00000162891

Protein

UniProt ID

Q9NYY1

Protein name

Interleukin-20 (IL-20) (Cytokine Zcyto10)

Protein function

Pro-inflammatory and angiogenic cytokine mainly secreted by monocytes and skin keratinocytes that plays crucial roles in immune responses, regulation of inflammatory responses, hemopoiesis, as well as epidermal cell and keratinocyte differentiat

PDB

4DOH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00726	IL10	20 → 175	Interleukin 10	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in most tissues and five major cell types: epithelial cells (primarily skin, buccal mucosa, tongue, nasal mucosa, lung, ureter, breast, prostate, fallopian tube, and adrenal gland), myoepithelial cells (mainly prostate), endo

Sequence

MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNI
DIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIK
KDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

Sequence length

176

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor JAK-STAT signaling pathway		Interleukin-20 family signaling

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Inflammatory Bowel Disease	Inflammatory bowel disease (MTAG)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arthritis Juvenile	Associate	16959027, 23094074
Arthritis Psoriatic	Associate	16645593, 16831294, 23006144
Arthritis Rheumatoid	Associate	22355377, 23006144, 26968800, 27799070, 35384009
Asthma	Associate	25543042
Atherosclerosis	Associate	31947776
Breast Neoplasms	Associate	27806114, 28514748
Diabetes Mellitus	Associate	26354610
Diabetes Mellitus Type 1	Associate	19430480
Diabetes Mellitus Type 2	Associate	26354610
Fibrosis	Associate	25404022, 37874141
Hepatitis B	Associate	18479293
Hepatitis B Chronic	Associate	18479293
Hyperplasia	Associate	16645593
Immune System Diseases	Associate	35384009
Infections	Stimulate	37874141
Inflammation	Associate	16645593, 22962576, 23271730, 31947776, 31973719, 40133606
Mouth Diseases	Associate	16645593
Myasthenia Gravis	Stimulate	27172995
Myasthenia Gravis	Associate	30945700
Myotonic Dystrophy	Inhibit	26354610
Neoplasms	Associate	28514748, 38033043
Non Muscle Invasive Bladder Neoplasms	Stimulate	22962576
Psoriasis	Associate	16645593, 23006144, 27799070
Status Asthmaticus	Associate	25543042
Tuberculosis	Associate	26354610
Urinary Bladder Neoplasms	Associate	22962576, 23271730
Uveitis	Associate	18802119

IL20 (interleukin 20)