Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4998
Gene name Gene Name - the full gene name approved by the HGNC.
Origin recognition complex subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ORC1
Synonyms (NCBI Gene) Gene synonyms aliases
HSORC1, ORC1L, PARC1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p32.3
Summary Summary of gene provided in NCBI Entrez Gene.
The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs143141689 C>T Pathogenic, likely-pathogenic Coding sequence variant, 5 prime UTR variant, missense variant
rs201253919 G>A Pathogenic Missense variant, coding sequence variant
rs387906826 T>C Pathogenic Coding sequence variant, 5 prime UTR variant, missense variant
rs387906827 A>G Pathogenic Coding sequence variant, 5 prime UTR variant, missense variant
rs387906828 C>T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023064 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT024795 hsa-miR-215-5p Microarray 19074876
MIRT026765 hsa-miR-192-5p Microarray 19074876
MIRT044432 hsa-miR-320a CLASH 23622248
MIRT040662 hsa-miR-92b-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle TAS
GO:0000083 Process Regulation of transcription involved in G1/S transition of mitotic cell cycle TAS
GO:0000781 Component Chromosome, telomeric region HDA 19135898
GO:0000781 Component Chromosome, telomeric region IDA 24270157
GO:0000808 Component Origin recognition complex IDA 17716973
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601902 8487 ENSG00000085840
Protein
UniProt ID Q13415
Protein name Origin recognition complex subunit 1 (Replication control protein 1)
Protein function Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication
PDB 5UJ7 , 5UJM , 6P3W , 7CTF , 7CTG , 7JPO , 7JPP , 7JPR , 7JPS , 8RWV , 8S0C , 8S0D , 8S0E , 8S0F
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01426 BAH 45 169 BAH domain Domain
PF00004 AAA 530 675 ATPase family associated with various cellular activities (AAA) Domain
PF17872 AAA_lid_10 669 738 AAA lid domain Domain
PF09079 Cdc6_C 778 857 CDC6, C terminal winged helix domain Domain
Sequence
MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDD
ENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQEIFWYDYPAC
DSNINAETIIGLVRVIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLS
SELFAELNKPQ
ESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELG
NLGNPQMSQQTSCASLDSPGRIKRKVAFSEITSPSKRSQPDKLQTLSPALKAPEKTRETG
LSYTEDDKKASPEHRIILRTRIAASKTIDIREERTLTPISGGQRSSVVPSVILKPENIKK
RDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQLRFLGNSKSDQEEKEILPAAEISDSS
SDEEEASTPPLPRRAPRTVSRNLRSSLKSSLHTLTKVPKKSLKPRTPRCAAPQIRSRSLA
AQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGK
TATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAEL
LAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPE
RIMMNRVS
SRLGLTRMCFQPYTYSQLQQILRSRLKHLKAFEDDAIQLVARKVAALSGDAR
RCLDICRRATEICEFSQQ
KPDSPGLVTIAHSMEAVDEMFSSSYITAIKNSSVLEQSFLRA
ILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRND
LLLRVRLNVSQDDVLYA
LKDE
Sequence length 861
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle   Activation of ATR in response to replication stress
Assembly of the ORC complex at the origin of replication
CDC6 association with the ORC:origin complex
CDT1 association with the CDC6:ORC:origin complex
Assembly of the pre-replicative complex
Orc1 removal from chromatin
Activation of the pre-replicative complex
G1/S-Specific Transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Craniosynostosis Craniosynostosis rs104893895, rs587777006, rs587777007, rs587777008, rs587777010, rs864321680, rs864321681, rs1057517670, rs1064794325, rs1555750816, rs1599823350
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Meier-gorlin syndrome MEIER-GORLIN SYNDROME 1 rs121918494, rs387906826, rs143141689, rs387906828, rs1557573504, rs1378348220, rs387906842, rs387906847, rs797044461, rs387906917, rs147914553, rs779871947, rs387906918, rs200652608, rs786205258
View all (16 more)
21358632, 21358631, 22855792, 24896178, 21358633, 25689043, 23023959, 8943353
Unknown
Disease term Disease name Evidence References Source
Specific learning disorder Specific learning disability ClinVar
Gorlin Syndrome Meier-Gorlin syndrome GenCC
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 39334882
Adenocarcinoma of Lung Associate 32121037, 36205357
Arrhythmogenic Right Ventricular Dysplasia Associate 31843279
Breast Neoplasms Associate 21040551, 35639264
Carcinogenesis Associate 36205357
Carcinoma Hepatocellular Associate 34853791
Colorectal Neoplasms Associate 37945594
Craniofacial Fibrous Dysplasia Associate 33157955
Developmental Disabilities Associate 33157955
Drug Hypersensitivity Stimulate 23364533