CRNN (cornulin)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
49860
Gene name Gene Name - the full gene name approved by the HGNC.
Cornulin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CRNN
Synonyms (NCBI Gene) Gene synonyms aliases
C1orf10, DRC1, PDRC1, SEP53
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the "fused gene" family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threoni
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT018209 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(20)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA 21873635
GO:0005509 Function Calcium ion binding NAS 11056050
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm TAS 14967811
GO:0009408 Process Response to heat IDA 11606197
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
611312 1230 ENSG00000143536
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9UBG3
Protein name Cornulin (53 kDa putative calcium-binding protein) (53 kDa squamous epithelial-induced stress protein) (58 kDa heat shock protein) (Squamous epithelial heat shock protein 53) (Tumor-related protein)
Protein function Promotes cell proliferation, G1/S cell cycle progression and induces expression of the cell cycle regulator CCND1 (PubMed:30009832). Regulates proliferation induced by pro-inflammatory cytokine response via activation of NFKB1 and PI3K/AKT signa
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 4 → 46 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the basal skin layer (at protein level) (PubMed:30009832). Squamous epithelia cell-specific. Expressed in the esophagus (periphery of the cells of the granular and the upper spinous layers), foreskin (granular and lower co
Sequence 
MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRL
LDEDHTGTVEFKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSG
TEVGRAGKGQHYEGSSHRQSQQGSRGQNRPGVQTQGQATGSAWVSSYDRQAESQSQERIS
PQIQLSGQTEQTQKAGEGKRNQTTEMRPERQPQTREQDRAHQTGETVTGSGTQTQAGATQ
TVEQDSSHQTGRTSKQTQEATNDQNRGTETHGQGRSQTSQAVTGGHAQIQAGTHTQTPTQ
TVEQDSSHQTGSTSTQTQESTNGQNRGTEIHGQGRSQTSQAVTGGHTQIQAGSHTETVEQ
DRSQTVSHGGAREQGQTQTQPGSGQRWMQVSNPEAGETVPGGQAQTGASTESGRQEWSST
HPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
ITARELYSYLRSTKP
Sequence length 495
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Esophageal carcinoma Esophageal carcinoma rs121912967 19558548
Show/Hide Text Mining Associations (17)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Basal Cell Associate 37059366
Dermatitis Atopic Associate 32213830
Diarrhea 5 With Tufting Enteropathy Congenital Associate 39706768
Endometrial Neoplasms Associate 36807337
Eosinophilic Esophagitis Inhibit 28104354
Esophageal Squamous Cell Carcinoma Inhibit 24263008
Esophageal Squamous Cell Carcinoma Associate 37553345
Laryngopharyngeal Reflux Associate 19861202
Lymphatic Metastasis Inhibit 24263008
Lymphoma T Cell Cutaneous Associate 32213830