CRNN (cornulin)

Gene

• Entrez ID: 49860
• Gene name: Cornulin
• Gene symbol: CRNN
• Synonyms (NCBI Gene): C1orf10, DRC1, PDRC1, SEP53
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes a member of the "fused gene" family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threoni

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018209	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	NAS	11056050
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IDA	15854041
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	14967811
GO:0009408	Process	Response to heat	IDA	11606197
GO:0010468	Process	Regulation of gene expression	IMP	30009832
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IMP	30009832
GO:0016020	Component	Membrane	IDA	2980212
GO:0046872	Function	Metal ion binding	IEA
GO:0046914	Function	Transition metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	30009832
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	30009832
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	30009832
GO:0098609	Process	Cell-cell adhesion	IDA	2631556
GO:1902808	Process	Positive regulation of cell cycle G1/S phase transition	IMP	30009832

Other IDs

• MIM: 611312
• HGNC: 1230
• e!Ensembl: ENSG00000143536

Protein

• UniProt ID: Q9UBG3
• Protein name: Cornulin (53 kDa putative calcium-binding protein) (53 kDa squamous epithelial-induced stress protein) (58 kDa heat shock protein) (Squamous epithelial heat shock protein 53) (Tumor-related protein)
• Protein function: Promotes cell proliferation, G1/S cell cycle progression and induces expression of the cell cycle regulator CCND1 (PubMed:30009832). Regulates proliferation induced by pro-inflammatory cytokine response via activation of NFKB1 and PI3K/AKT signa
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	4 → 46	S-100/ICaBP type calcium binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the basal skin layer (at protein level) (PubMed:30009832). Squamous epithelia cell-specific. Expressed in the esophagus (periphery of the cells of the granular and the upper spinous layers), foreskin (granular and lower co
• Sequence:

  MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRL
  LDEDHTGTVEFKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSG
  TEVGRAGKGQHYEGSSHRQSQQGSRGQNRPGVQTQGQATGSAWVSSYDRQAESQSQERIS
  PQIQLSGQTEQTQKAGEGKRNQTTEMRPERQPQTREQDRAHQTGETVTGSGTQTQAGATQ
  TVEQDSSHQTGRTSKQTQEATNDQNRGTETHGQGRSQTSQAVTGGHAQIQAGTHTQTPTQ
  TVEQDSSHQTGSTSTQTQESTNGQNRGTEIHGQGRSQTSQAVTGGHTQIQAGSHTETVEQ
  DRSQTVSHGGAREQGQTQTQPGSGQRWMQVSNPEAGETVPGGQAQTGASTESGRQEWSST
  HPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
  ITARELYSYLRSTKP

• Sequence length: 495