Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	49860
Gene name Gene Name - the full gene name approved by the HGNC.	Cornulin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CRNN
Synonyms (NCBI Gene) Gene synonyms aliases	C1orf10, DRC1, PDRC1, SEP53
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the "fused gene" family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threoni

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018209	hsa-miR-335-5p	Microarray	18185580

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	NAS	11056050
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IDA	15854041
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	14967811
GO:0009408	Process	Response to heat	IDA	11606197
GO:0010468	Process	Regulation of gene expression	IMP	30009832
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IMP	30009832
GO:0016020	Component	Membrane	IDA	2980212
GO:0046872	Function	Metal ion binding	IEA
GO:0046914	Function	Transition metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	30009832
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	30009832
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	30009832
GO:0098609	Process	Cell-cell adhesion	IDA	2631556
GO:1902808	Process	Positive regulation of cell cycle G1/S phase transition	IMP	30009832

MIM	HGNC	e!Ensembl
611312	1230	ENSG00000143536

Protein

UniProt ID

Q9UBG3

Protein name

Cornulin (53 kDa putative calcium-binding protein) (53 kDa squamous epithelial-induced stress protein) (58 kDa heat shock protein) (Squamous epithelial heat shock protein 53) (Tumor-related protein)

Protein function

Promotes cell proliferation, G1/S cell cycle progression and induces expression of the cell cycle regulator CCND1 (PubMed:30009832). Regulates proliferation induced by pro-inflammatory cytokine response via activation of NFKB1 and PI3K/AKT signa

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01023	S_100	4 → 46	S-100/ICaBP type calcium binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the basal skin layer (at protein level) (PubMed:30009832). Squamous epithelia cell-specific. Expressed in the esophagus (periphery of the cells of the granular and the upper spinous layers), foreskin (granular and lower co

Sequence

MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRL
LDEDHTGTVEFKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSG
TEVGRAGKGQHYEGSSHRQSQQGSRGQNRPGVQTQGQATGSAWVSSYDRQAESQSQERIS
PQIQLSGQTEQTQKAGEGKRNQTTEMRPERQPQTREQDRAHQTGETVTGSGTQTQAGATQ
TVEQDSSHQTGRTSKQTQEATNDQNRGTETHGQGRSQTSQAVTGGHAQIQAGTHTQTPTQ
TVEQDSSHQTGSTSTQTQESTNGQNRGTEIHGQGRSQTSQAVTGGHTQIQAGSHTETVEQ
DRSQTVSHGGAREQGQTQTQPGSGQRWMQVSNPEAGETVPGGQAQTGASTESGRQEWSST
HPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
ITARELYSYLRSTKP

Sequence length

495

Interactions

View interactions

CRNN (cornulin)