Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4982
Gene name Gene Name - the full gene name approved by the HGNC.	TNF receptor superfamily member 11b
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TNFRSF11B
Synonyms (NCBI Gene) Gene synonyms aliases	OCIF, OPG, PDB5, TR1
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.12
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin l

Show/Hide all(9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894091	C>T	Pathogenic	Coding sequence variant, missense variant
rs104894092	A>G	Pathogenic	Coding sequence variant, missense variant
rs144654126	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs146450643	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs200071478	T>C,G	Pathogenic	Missense variant, coding sequence variant
rs786205594	C>A	Likely-pathogenic	Coding sequence variant, missense variant
rs796051868	CGT>-	Pathogenic	Inframe deletion, coding sequence variant
rs1307942060	G>A	Pathogenic	Coding sequence variant, stop gained
rs1554617110	->C	Likely-pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(219)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023202	hsa-miR-124-3p	Microarray	18668037
MIRT031067	hsa-miR-21-5p	Microarray	20371350
MIRT053664	hsa-miR-181a-5p	Microarray	22942087
MIRT1442877	hsa-miR-135a	CLIP-seq
MIRT1442878	hsa-miR-135b	CLIP-seq
MIRT1442879	hsa-miR-3119	CLIP-seq
MIRT1442880	hsa-miR-3160-5p	CLIP-seq
MIRT1442881	hsa-miR-4263	CLIP-seq
MIRT1442882	hsa-miR-576-5p	CLIP-seq
MIRT1555056	hsa-miR-1283	CLIP-seq
MIRT1555057	hsa-miR-1294	CLIP-seq
MIRT1555058	hsa-miR-199a-3p	CLIP-seq
MIRT1555059	hsa-miR-199b-3p	CLIP-seq
MIRT1555060	hsa-miR-216a	CLIP-seq
MIRT1555061	hsa-miR-221	CLIP-seq
MIRT1555062	hsa-miR-222	CLIP-seq
MIRT1555063	hsa-miR-3129-5p	CLIP-seq
MIRT1555064	hsa-miR-3145-3p	CLIP-seq
MIRT1555065	hsa-miR-3163	CLIP-seq
MIRT1555066	hsa-miR-3180-5p	CLIP-seq
MIRT1555067	hsa-miR-330-3p	CLIP-seq
MIRT1555068	hsa-miR-3662	CLIP-seq
MIRT1555069	hsa-miR-371-5p	CLIP-seq
MIRT1555070	hsa-miR-371b-5p	CLIP-seq
MIRT1555071	hsa-miR-3915	CLIP-seq
MIRT1555072	hsa-miR-3928	CLIP-seq
MIRT1555073	hsa-miR-3935	CLIP-seq
MIRT1555074	hsa-miR-4261	CLIP-seq
MIRT1555075	hsa-miR-4282	CLIP-seq
MIRT1555076	hsa-miR-4307	CLIP-seq
MIRT1555077	hsa-miR-4316	CLIP-seq
MIRT1555078	hsa-miR-4496	CLIP-seq
MIRT1555079	hsa-miR-450b-3p	CLIP-seq
MIRT1555080	hsa-miR-4713-3p	CLIP-seq
MIRT1555081	hsa-miR-548v	CLIP-seq
MIRT1555082	hsa-miR-577	CLIP-seq
MIRT1555083	hsa-miR-586	CLIP-seq
MIRT1555084	hsa-miR-587	CLIP-seq
MIRT1555085	hsa-miR-638	CLIP-seq
MIRT1555086	hsa-miR-769-3p	CLIP-seq
MIRT1555087	hsa-miR-885-5p	CLIP-seq
MIRT1555088	hsa-miR-936	CLIP-seq
MIRT2132537	hsa-miR-124	CLIP-seq
MIRT2132538	hsa-miR-1289	CLIP-seq
MIRT1555057	hsa-miR-1294	CLIP-seq
MIRT2132539	hsa-miR-3198	CLIP-seq
MIRT2132540	hsa-miR-3714	CLIP-seq
MIRT2132541	hsa-miR-3910	CLIP-seq
MIRT1555071	hsa-miR-3915	CLIP-seq
MIRT1555072	hsa-miR-3928	CLIP-seq
MIRT2132542	hsa-miR-4294	CLIP-seq
MIRT2132543	hsa-miR-4309	CLIP-seq
MIRT1555077	hsa-miR-4316	CLIP-seq
MIRT1555079	hsa-miR-450b-3p	CLIP-seq
MIRT1555080	hsa-miR-4713-3p	CLIP-seq
MIRT2132544	hsa-miR-506	CLIP-seq
MIRT1555085	hsa-miR-638	CLIP-seq
MIRT1555086	hsa-miR-769-3p	CLIP-seq
MIRT2434154	hsa-miR-1183	CLIP-seq
MIRT2434155	hsa-miR-1251	CLIP-seq
MIRT2434156	hsa-miR-1265	CLIP-seq
MIRT1555056	hsa-miR-1283	CLIP-seq
MIRT2132538	hsa-miR-1289	CLIP-seq
MIRT1442877	hsa-miR-135a	CLIP-seq
MIRT1442878	hsa-miR-135b	CLIP-seq
MIRT2434157	hsa-miR-181a	CLIP-seq
MIRT2434158	hsa-miR-181b	CLIP-seq
MIRT2434159	hsa-miR-181c	CLIP-seq
MIRT2434160	hsa-miR-181d	CLIP-seq
MIRT2434161	hsa-miR-183	CLIP-seq
MIRT2434162	hsa-miR-200b	CLIP-seq
MIRT2434163	hsa-miR-200c	CLIP-seq
MIRT2434164	hsa-miR-2054	CLIP-seq
MIRT2434165	hsa-miR-21	CLIP-seq
MIRT1555060	hsa-miR-216a	CLIP-seq
MIRT1555061	hsa-miR-221	CLIP-seq
MIRT1555062	hsa-miR-222	CLIP-seq
MIRT2434166	hsa-miR-224	CLIP-seq
MIRT2434167	hsa-miR-2392	CLIP-seq
MIRT1442879	hsa-miR-3119	CLIP-seq
MIRT2434168	hsa-miR-3121-3p	CLIP-seq
MIRT1555064	hsa-miR-3145-3p	CLIP-seq
MIRT2434169	hsa-miR-3145-5p	CLIP-seq
MIRT1442880	hsa-miR-3160-5p	CLIP-seq
MIRT1555065	hsa-miR-3163	CLIP-seq
MIRT2434170	hsa-miR-3170	CLIP-seq
MIRT2132539	hsa-miR-3198	CLIP-seq
MIRT2434171	hsa-miR-3200-5p	CLIP-seq
MIRT1555067	hsa-miR-330-3p	CLIP-seq
MIRT2434172	hsa-miR-340	CLIP-seq
MIRT2434173	hsa-miR-34a	CLIP-seq
MIRT2434174	hsa-miR-34c-5p	CLIP-seq
MIRT1555068	hsa-miR-3662	CLIP-seq
MIRT2434175	hsa-miR-3682-3p	CLIP-seq
MIRT1555069	hsa-miR-371-5p	CLIP-seq
MIRT1555070	hsa-miR-371b-5p	CLIP-seq
MIRT2434176	hsa-miR-3908	CLIP-seq
MIRT2434177	hsa-miR-3942-3p	CLIP-seq
MIRT2434178	hsa-miR-3942-5p	CLIP-seq
MIRT2434179	hsa-miR-4255	CLIP-seq
MIRT2434180	hsa-miR-4260	CLIP-seq
MIRT2434181	hsa-miR-4262	CLIP-seq
MIRT1442881	hsa-miR-4263	CLIP-seq
MIRT1555075	hsa-miR-4282	CLIP-seq
MIRT2434182	hsa-miR-429	CLIP-seq
MIRT2132542	hsa-miR-4294	CLIP-seq
MIRT1555076	hsa-miR-4307	CLIP-seq
MIRT2132543	hsa-miR-4309	CLIP-seq
MIRT2434183	hsa-miR-4330	CLIP-seq
MIRT2434184	hsa-miR-4427	CLIP-seq
MIRT2434185	hsa-miR-4443	CLIP-seq
MIRT2434186	hsa-miR-449a	CLIP-seq
MIRT2434187	hsa-miR-449b	CLIP-seq
MIRT1555079	hsa-miR-450b-3p	CLIP-seq
MIRT2434188	hsa-miR-4517	CLIP-seq
MIRT2434189	hsa-miR-4540	CLIP-seq
MIRT2434190	hsa-miR-4645-3p	CLIP-seq
MIRT2434191	hsa-miR-4668-3p	CLIP-seq
MIRT2434192	hsa-miR-4680-3p	CLIP-seq
MIRT2434193	hsa-miR-4703-5p	CLIP-seq
MIRT1555080	hsa-miR-4713-3p	CLIP-seq
MIRT2434194	hsa-miR-4729	CLIP-seq
MIRT2434195	hsa-miR-4753-3p	CLIP-seq
MIRT2434196	hsa-miR-4762-5p	CLIP-seq
MIRT2434197	hsa-miR-4766-3p	CLIP-seq
MIRT2434198	hsa-miR-4768-5p	CLIP-seq
MIRT2434199	hsa-miR-4775	CLIP-seq
MIRT2434200	hsa-miR-4789-5p	CLIP-seq
MIRT2434201	hsa-miR-4799-5p	CLIP-seq
MIRT2434202	hsa-miR-508-5p	CLIP-seq
MIRT2434203	hsa-miR-539	CLIP-seq
MIRT2434204	hsa-miR-548aa	CLIP-seq
MIRT2434205	hsa-miR-548ag	CLIP-seq
MIRT2434206	hsa-miR-548ai	CLIP-seq
MIRT2434207	hsa-miR-548c-3p	CLIP-seq
MIRT1555081	hsa-miR-548v	CLIP-seq
MIRT1442882	hsa-miR-576-5p	CLIP-seq
MIRT1555082	hsa-miR-577	CLIP-seq
MIRT2434208	hsa-miR-579	CLIP-seq
MIRT1555083	hsa-miR-586	CLIP-seq
MIRT1555084	hsa-miR-587	CLIP-seq
MIRT2434209	hsa-miR-590-3p	CLIP-seq
MIRT2434210	hsa-miR-590-5p	CLIP-seq
MIRT2434211	hsa-miR-616	CLIP-seq
MIRT2434212	hsa-miR-629	CLIP-seq
MIRT2434213	hsa-miR-633	CLIP-seq
MIRT1555085	hsa-miR-638	CLIP-seq
MIRT2434214	hsa-miR-656	CLIP-seq
MIRT2434215	hsa-miR-765	CLIP-seq
MIRT1555086	hsa-miR-769-3p	CLIP-seq
MIRT2434216	hsa-miR-802	CLIP-seq
MIRT1555087	hsa-miR-885-5p	CLIP-seq
MIRT1555057	hsa-miR-1294	CLIP-seq
MIRT2434170	hsa-miR-3170	CLIP-seq
MIRT2434180	hsa-miR-4260	CLIP-seq
MIRT1555077	hsa-miR-4316	CLIP-seq
MIRT1555079	hsa-miR-450b-3p	CLIP-seq
MIRT2434190	hsa-miR-4645-3p	CLIP-seq
MIRT1555080	hsa-miR-4713-3p	CLIP-seq
MIRT2434203	hsa-miR-539	CLIP-seq
MIRT2434212	hsa-miR-629	CLIP-seq
MIRT1555085	hsa-miR-638	CLIP-seq
MIRT1555086	hsa-miR-769-3p	CLIP-seq
MIRT2647684	hsa-miR-10a	CLIP-seq
MIRT2647685	hsa-miR-10b	CLIP-seq
MIRT1555057	hsa-miR-1294	CLIP-seq
MIRT2647686	hsa-miR-3150b-3p	CLIP-seq
MIRT2434170	hsa-miR-3170	CLIP-seq
MIRT1555066	hsa-miR-3180-5p	CLIP-seq
MIRT2647687	hsa-miR-3187-3p	CLIP-seq
MIRT2647688	hsa-miR-34c-3p	CLIP-seq
MIRT2647689	hsa-miR-3688-5p	CLIP-seq
MIRT1555071	hsa-miR-3915	CLIP-seq
MIRT1555072	hsa-miR-3928	CLIP-seq
MIRT2434180	hsa-miR-4260	CLIP-seq
MIRT1555074	hsa-miR-4261	CLIP-seq
MIRT1555077	hsa-miR-4316	CLIP-seq
MIRT2647690	hsa-miR-4420	CLIP-seq
MIRT2434185	hsa-miR-4443	CLIP-seq
MIRT2647691	hsa-miR-4470	CLIP-seq
MIRT2647692	hsa-miR-4490	CLIP-seq
MIRT1555078	hsa-miR-4496	CLIP-seq
MIRT1555079	hsa-miR-450b-3p	CLIP-seq
MIRT2647693	hsa-miR-4529-5p	CLIP-seq
MIRT2434189	hsa-miR-4540	CLIP-seq
MIRT2434190	hsa-miR-4645-3p	CLIP-seq
MIRT1555080	hsa-miR-4713-3p	CLIP-seq
MIRT2647694	hsa-miR-4766-5p	CLIP-seq
MIRT2647695	hsa-miR-4784	CLIP-seq
MIRT2647696	hsa-miR-515-5p	CLIP-seq
MIRT2434203	hsa-miR-539	CLIP-seq
MIRT2434212	hsa-miR-629	CLIP-seq
MIRT1555085	hsa-miR-638	CLIP-seq
MIRT2434215	hsa-miR-765	CLIP-seq
MIRT1555086	hsa-miR-769-3p	CLIP-seq
MIRT1555057	hsa-miR-1294	CLIP-seq
MIRT2647686	hsa-miR-3150b-3p	CLIP-seq
MIRT2434170	hsa-miR-3170	CLIP-seq
MIRT1555066	hsa-miR-3180-5p	CLIP-seq
MIRT2647687	hsa-miR-3187-3p	CLIP-seq
MIRT1555071	hsa-miR-3915	CLIP-seq
MIRT1555072	hsa-miR-3928	CLIP-seq
MIRT2434180	hsa-miR-4260	CLIP-seq
MIRT1555074	hsa-miR-4261	CLIP-seq
MIRT1555077	hsa-miR-4316	CLIP-seq
MIRT2434185	hsa-miR-4443	CLIP-seq
MIRT1555078	hsa-miR-4496	CLIP-seq
MIRT1555079	hsa-miR-450b-3p	CLIP-seq
MIRT2647693	hsa-miR-4529-5p	CLIP-seq
MIRT2434189	hsa-miR-4540	CLIP-seq
MIRT2434190	hsa-miR-4645-3p	CLIP-seq
MIRT1555080	hsa-miR-4713-3p	CLIP-seq
MIRT2647695	hsa-miR-4784	CLIP-seq
MIRT2647696	hsa-miR-515-5p	CLIP-seq
MIRT2434203	hsa-miR-539	CLIP-seq
MIRT2434212	hsa-miR-629	CLIP-seq
MIRT1555085	hsa-miR-638	CLIP-seq
MIRT2434215	hsa-miR-765	CLIP-seq
MIRT1555086	hsa-miR-769-3p	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
CREB5	Repression	21132541
HOXC8	Unknown	11139569
PPARG	Unknown	12056809
SMAD1	Unknown	11139569

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	TAS	9108485
GO:0005125	Function	Cytokine activity	TAS	9168977
GO:0005515	Function	Protein binding	IPI	22664871, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	22664871
GO:0005576	Component	Extracellular region	TAS	9108485
GO:0005615	Component	Extracellular space	IDA	15516325
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9168977
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	IEA
GO:0038023	Function	Signaling receptor activity	TAS	9108485
GO:0042489	Process	Negative regulation of odontogenesis of dentin-containing tooth	IEA
GO:0043235	Component	Receptor complex	IPI	9168977
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	ISO
GO:1904399	Function	Heparan sulfate binding	IEA

MIM	HGNC	e!Ensembl
602643	11909	ENSG00000164761

Protein

UniProt ID

O00300

Protein name

Tumor necrosis factor receptor superfamily member 11B (Osteoclastogenesis inhibitory factor) (Osteoprotegerin)

Protein function

Acts as a decoy receptor for TNFSF11/RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local ratio between

PDB

3URF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	25 → 62	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	65 → 105	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	107 → 142	TNFR/NGFR cysteine-rich region	Domain
PF00531	Death	278 → 365	Death domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal m

Sequence

MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKT
VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK
HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT
HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI
KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME
SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT
VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Sequence length

401

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Osteoclast differentiation		TNFs bind their physiological receptors

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hyperphosphatasemia With Bone Disease	hyperphosphatasemia with bone disease	rs2129878039, rs200071478, rs1307942060, rs796051868, rs104894091	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (256)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acidemia isovaleric	Associate	20723612
Acro Osteolysis	Associate	29680857
Acromegaly	Associate	39741885
Acute Coronary Syndrome	Stimulate	23788300
Addison Disease	Stimulate	23388484
Aggressive Periodontitis	Inhibit	32074214
Albuminuria	Associate	21940840
Alveolar Bone Loss	Associate	25814780
Alzheimer Disease	Associate	39394418
Ameloblastoma	Associate	21643971
Amyotrophic Lateral Sclerosis	Inhibit	18389210
Amyotrophic Lateral Sclerosis	Associate	19502537, 21659498, 28090190
Amyotrophic Lateral Sclerosis	Stimulate	25811776
Aneuploidy	Stimulate	26608463
Aneuploidy	Associate	27270654
Angina Unstable	Associate	34418901
Anodontia	Associate	19502537
Aortic Aneurysm Abdominal	Associate	19438902, 31703088
Aortic Aneurysm Familial Abdominal 1	Inhibit	31703088
Aortic Valve Calcification of	Associate	27003233, 28246602
Aortic Valve Disease	Associate	28821297
Aortic Valve Stenosis	Associate	28246602, 32089075
Arthritis Juvenile	Associate	37328895
Arthritis Rheumatoid	Inhibit	11352231, 25837853, 27542839
Arthritis Rheumatoid	Associate	15270863, 15593184, 16385498, 17341304, 18576301, 22377704, 24295447, 24886600, 25105978, 25679449, 26065000, 26125863, 26350950, 28758134, 35680906
Arthritis Rheumatoid	Stimulate	25967362, 27403809
Arthropathy progressive pseudorheumatoid of childhood	Associate	18156213
Ataxia Telangiectasia	Associate	23564641
Atherosclerosis	Associate	17706953, 20961967, 23788300, 25184828, 26184866, 26664786, 28761062, 33817720, 35680906
Atherosclerosis	Stimulate	23666878
Atherosclerosis	Inhibit	28849089
Atrial Fibrillation	Stimulate	22001292
Atrial Fibrillation	Inhibit	37532154
Atrial Remodeling	Associate	22001292
Axial Spondyloarthritis	Associate	29303699
Barakat syndrome	Associate	26216189
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	22864527
Blindness	Associate	17352649
Bone Cysts Aneurysmal	Associate	22330339
Bone Diseases	Associate	11274143, 11393778, 11739153, 15238139, 15753532, 16135836, 17996099, 23756197, 24074513, 24676726, 24700654, 25393853, 26094529, 26617755, 26913505 View all (4 more)
Bone Diseases	Inhibit	19346738
Bone Diseases Metabolic	Associate	15068494, 19346738, 24841655, 27639566, 28260003, 28758134, 37328895, 37751449, 40332270
Bone Diseases Metabolic	Inhibit	18490014
Bone Marrow Diseases	Inhibit	32383346
Bone Resorption	Associate	18634923, 21360521, 21467819, 23388484, 31944625, 36147560
Bone Resorption	Stimulate	19627525
Bone Resorption	Inhibit	21075196
Brain Injuries Traumatic	Associate	36403069
Breast Neoplasms	Associate	16394281, 18546262, 18584413, 23369128, 24026883, 26608463, 27191503, 27270654, 28002811, 28143606, 28387573, 28420351
Breast Neoplasms	Stimulate	19604388
Breast Neoplasms	Inhibit	27893411
Calcinosis	Associate	16449517, 17056676, 20004120, 20723612, 22402034, 28056805
Calcinosis	Inhibit	24586847
Calcinosis Cutis	Associate	18684318
Carcinogenesis	Associate	34570303
Carcinoma Giant Cell	Associate	35697931
Carcinoma Hepatocellular	Associate	23307318, 36189226, 37990105, 40243557
Carcinoma Renal Cell	Associate	26528707
Cardiomyopathy Hypertrophic	Associate	20723612
Cardiovascular Diseases	Associate	22001292, 24699314, 24758546, 25184828, 29303699, 32955941, 37532154
Cardiovascular Diseases	Stimulate	33081726
Carotid Stenosis	Associate	18178454, 20004120, 22402034, 33817720, 35680906
Cartilage Diseases	Associate	35412619
Cementoma	Associate	38107708
Cerebral Infarction	Associate	29501268
Cerebrovascular Disorders	Associate	25184828
Chest Pain	Associate	23788300
Chondrocalcinosis	Associate	29578045, 35412619
Chronic Disease	Stimulate	22737245
Chronic Kidney Disease Mineral and Bone Disorder	Associate	18455228, 25393853
Chronic Limb Threatening Ischemia	Associate	27387019
Chronic Periodontitis	Associate	25814780, 31944625
Clear cell metastatic renal cell carcinoma	Associate	26528707
Cleft Palate	Associate	31944625
Colitis Ulcerative	Stimulate	15753532
Colorectal Neoplasms	Inhibit	26942563, 27764814
Colorectal Neoplasms	Associate	34938284, 38049731
Coronary Artery Disease	Associate	21678453, 23788300, 24699314, 25679449, 29330256, 32955941
Coronary Artery Disease	Stimulate	28821297
Coronary Disease	Associate	26400332
Coronary Disease	Inhibit	37532154
Coxa Magna	Associate	27336899
Coxa Magna	Stimulate	32667225
Craniosynostoses	Associate	23322328
Crohn Disease	Stimulate	15544627, 15753532
Crohn Disease	Associate	18942021, 27639566
Cushing's symphalangism	Associate	26184866
Cysts	Associate	21683340
Deafness	Associate	17352649
Death	Associate	23788300
Dental Plaque	Associate	22402034
Dentigerous Cyst	Associate	21683340, 36507759
Diabetes Gestational	Associate	26094529
Diabetes Mellitus	Associate	17056676, 19502537, 21659498, 25811776, 28787318, 32096548, 33081726
Diabetes Mellitus	Stimulate	34487291
Diabetes Mellitus	Inhibit	37728820
Diabetes Mellitus Type 2	Associate	23299915, 23302066, 24228244, 25005034, 28761062, 32096548, 33081726, 34487291, 35463988, 37373436, 37838749
Diabetic Foot	Associate	23299915
Diabetic Retinopathy	Associate	24228244, 29115286
Disease	Associate	29303699
Dysentery Bacillary	Associate	34938284
Dyskinesias	Associate	31435075
Dystonia 12	Associate	25063546
Endocarditis	Stimulate	32087365
Epilepsy Tonic Clonic	Associate	19352306
Fabry Disease	Associate	30496606
Familial Mediterranean Fever	Associate	19346738
Femur Head Necrosis	Associate	26617755
Fibrocartilaginous embolism	Associate	20723612
Fibrosis	Stimulate	15982347
Fibrosis	Associate	20723612, 28787318
Fibrous Dysplasia of Bone	Associate	30496606
Fractures Bone	Associate	22207352
Gaucher Disease	Associate	25978039
Giant Cell Tumor of Bone	Stimulate	27163152
Glioma	Associate	35592520, 38225203
Hearing Loss	Associate	32298837
Hearing Loss Conductive	Inhibit	26216189
Hearing Loss Sensorineural	Associate	26216189
Heart Failure	Associate	23788300, 28787318, 28967680
Heart Valve Diseases	Associate	16449517, 27003233
Hemophilia A	Inhibit	26494839
Hemorrhage	Associate	29330256
Hemorrhagic Stroke	Associate	26664786
Hereditary Angioedema Type III	Associate	28260003
Hereditary Breast and Ovarian Cancer Syndrome	Associate	25380323
Hip Fractures	Associate	22807154, 25105978
HIV Infections	Associate	25393853, 26913505
Huntington Disease	Associate	26744893
Hypercalciuria Absorptive 2	Stimulate	18480302
Hyperostosis corticalis deformans juvenilis	Associate	12124406, 14672344, 15312251, 16135836, 17352649, 17388729, 23039992, 23322328, 25063546, 32298837, 37481965
Hyperparathyroidism Primary	Associate	22185226
Hyperparathyroidism Secondary	Associate	21940840
Hypertension	Associate	15223723, 28787318, 37838749
Hypertension	Inhibit	37532154
Hypertension	Stimulate	37838749
Hypertensive Retinopathy	Associate	17352649, 25005034
Hypoparathyroidism	Associate	26216189
Hypoxia	Stimulate	23307318
Hypoxia Brain	Stimulate	23307318
Immunologic Deficiency Syndromes	Associate	12124406
Infections	Stimulate	34846723
Inflammation	Associate	11274143, 17706953, 18426996, 20961967, 22737245, 24307062, 26608463, 27003233, 28143606, 30951949, 34418901, 35463988
Inflammatory Bowel Diseases	Associate	15753532, 27639566
Insulin Resistance	Associate	34487291
Jaw Diseases	Associate	22864527
Joint Diseases	Associate	12634226, 18576301, 25811776, 26494839
Juvenile osteoporosis	Associate	25177945
Kidney Diseases	Associate	25005034
Kidney Diseases	Stimulate	31881044
Liver Cirrhosis Biliary	Associate	24886600, 27631617
Lupus Erythematosus Systemic	Associate	22027240, 23666878, 24699314
Lymphangioleiomyomatosis	Associate	23867796
Lymphatic Metastasis	Associate	34938284
Lymphoma Non Hodgkin	Associate	37543576, 37713112
Mandibuloacral dysplasia with type A lipodystrophy	Associate	21419220
Melanoma	Associate	23490134
Metabolic Syndrome	Associate	25005034, 29303699
Metabolic Syndrome	Stimulate	28849089
MINOCA	Associate	23788300
Mitral Valve Prolapse	Associate	27338002
Monckeberg Medial Calcific Sclerosis	Associate	21659498
Mouth Diseases	Inhibit	27310953
Multiple Myeloma	Inhibit	11739153, 15238139, 26160841
Multiple Myeloma	Associate	15308561, 23178378, 24074513, 24280212, 26608463, 26669972
Multiple Sclerosis	Associate	35456036
Myocardial Infarction	Associate	21678453
Myocardial Infarction	Inhibit	37532154
Myxoma	Associate	29680857
Neoplasm Metastasis	Associate	18584413, 19846944, 23702841, 26528707, 26942563, 27191503, 27336899, 28577080, 34159752
Neoplasm Metastasis	Stimulate	23404437, 23490134
Neoplasm Metastasis	Inhibit	27764814
Neoplasms	Associate	15386310, 19604388, 21643971, 23241893, 23307318, 23369128, 23404437, 23867796, 26608463, 26942563, 27336899, 28002811, 28143606, 28420351, 28742795 View all (4 more)
Neoplasms	Inhibit	31435075
Neoplasms Vascular Tissue	Inhibit	11274143
Nerve Degeneration	Associate	20723612
Nervous System Diseases	Associate	25005034
Non Radiographic Axial Spondyloarthritis	Associate	16385498
Norrie disease	Associate	19502537
Obesity	Inhibit	31130968
Obesity	Associate	34487291, 35463988
Oculocerebrorenal Syndrome	Associate	18445777
Odontogenic Cysts	Associate	21643971, 21871606, 33768738, 36226690
Odontogenic Tumors	Associate	24972872, 29279565
Osteitis Deformans	Associate	15312251, 17388729, 37481965
Osteoarthritis	Associate	18565252, 19215023, 20723612, 25054223, 29578045, 31165896, 33989379
Osteoarthritis	Inhibit	19762475
Osteoarthritis Knee	Associate	20112374, 30972968
Osteolysis	Associate	14578201, 15238139, 21643971, 21659498, 33768738
Osteolysis	Inhibit	35222398
Osteomyelitis	Associate	34846723
Osteonecrosis	Associate	26617755
Osteopetrosis	Associate	25063546
Osteoporosis	Associate	15068494, 18455228, 19352306, 22377704, 22824048, 23388484, 23731710, 24067544, 24457406, 24615112, 25132170, 25148458, 26065000, 26930606, 27859736 View all (5 more)
Osteoporosis	Stimulate	19215023, 40332270
Osteoporosis	Inhibit	19877060
Osteoporosis Postmenopausal	Associate	27639566
Osteoporotic Fractures	Associate	12096838, 22807154, 28849089, 33374546
Osteoporotic Fractures	Inhibit	37751449
Osteosarcoma	Associate	17982618, 19671856, 26148858
Osteosclerosis	Stimulate	15982347
Pancreatic Neoplasms	Associate	37708964
Pancreatitis Chronic	Associate	26820620
Peri Implantitis	Associate	27828936
Periapical Granuloma	Associate	18634923
Periapical Periodontitis	Associate	18634923
Periodontal Diseases	Associate	12390325
Periodontitis	Associate	22126345
Periodontitis	Stimulate	31183390
Peripheral Arterial Disease	Stimulate	26184866
Peripheral Arterial Disease	Associate	27387019
Periprosthetic Fractures	Associate	16925460
Plaque Atherosclerotic	Associate	17706953, 33817720
Pneumonia	Associate	34938284
Polycystic Kidney Autosomal Dominant	Associate	24058411
Pre Eclampsia	Stimulate	22952959
Primary Myelofibrosis	Associate	15982347
Prostatic Neoplasms	Associate	16752412, 18684318, 19846944, 26608463
Prostatitis	Associate	16752412
Prosthesis Failure	Associate	35222398
Pulmonary Arterial Hypertension	Stimulate	18156213
Radial Neuropathy	Associate	23151010
Radicular Cyst	Associate	21643971
Raine syndrome	Associate	15307108
Renal Artery Obstruction	Associate	15223723
Renal Insufficiency Chronic	Associate	24058411, 31687048
Renal Insufficiency Chronic	Stimulate	34833374
Retinal Vein Occlusion	Associate	25978399
Retrograde Degeneration	Associate	36403069
Root Resorption	Stimulate	19627525
Sepsis	Associate	35463988
Shock Septic	Associate	35463988
Spondylarthritis	Associate	18311801
Spondylocostal dysostosis autosomal recessive	Associate	12096838, 22807154
Squamous Cell Carcinoma of Head and Neck	Inhibit	28742795
Stiff Skin Syndrome	Associate	21940840
Stiff Skin Syndrome	Stimulate	24307842, 28787318
Stomach Neoplasms	Associate	26608463
Stroke	Stimulate	30496210
Stroke	Associate	35463988
Synovial Cyst	Inhibit	10693864
Tertiary Lymphoid Structures	Stimulate	34938284
Thalassemia	Associate	15068494
Thalassemia	Stimulate	19352306
Thyroid Neoplasms	Associate	32588760
Tooth Loss	Associate	36403069
Tooth Resorption	Inhibit	18389210, 21474331, 24886600
Triple Negative Breast Neoplasms	Associate	27015557, 33297339, 34326372, 35631261
Tuberculosis Spinal	Inhibit	35463641
Urinary Bladder Neoplasms	Associate	15386310, 26608463
Vascular Calcification	Inhibit	11274143, 12067713, 18178454
Vascular Calcification	Associate	18945829, 21659498, 21940840, 23151010, 23302066, 24307842, 25005034, 27336899, 34833374, 37179214, 37728820
Vascular Diseases	Associate	26664786
Ventricular Remodeling	Stimulate	28787318
Vitamin D Deficiency	Associate	23322328
Wrist Fractures	Associate	22807154

TNFRSF11B (TNF receptor superfamily member 11b)