Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4968
Gene name Gene Name - the full gene name approved by the HGNC.	8-oxoguanine DNA glycosylase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OGG1
Synonyms (NCBI Gene) Gene synonyms aliases	HMMH, HOGG1, MUTM, OGH1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p25.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of th

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893751	G>A,C	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant

Show/Hide all(92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040345	hsa-miR-615-3p	CLASH	23622248
MIRT052750	hsa-miR-1260b	CLASH	23622248
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	FACS, In situ hybridization, RNA-seq, qRT-PCR, Western blotting	33000245
MIRT734696	hsa-miR-298	qRT-PCR	31484947
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT711096	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT711095	hsa-miR-1178-5p	HITS-CLIP	19536157
MIRT711094	hsa-miR-5092	HITS-CLIP	19536157
MIRT711093	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT711092	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT711091	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT711090	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT711089	hsa-miR-6825-5p	HITS-CLIP	19536157
MIRT711088	hsa-miR-6824-5p	HITS-CLIP	19536157
MIRT1202768	hsa-miR-1296	CLIP-seq
MIRT1202769	hsa-miR-3165	CLIP-seq
MIRT1202770	hsa-miR-3180	CLIP-seq
MIRT1202771	hsa-miR-3180-3p	CLIP-seq
MIRT1202772	hsa-miR-3190	CLIP-seq
MIRT1202773	hsa-miR-3196	CLIP-seq
MIRT1202774	hsa-miR-4512	CLIP-seq
MIRT1202775	hsa-miR-129-5p	CLIP-seq
MIRT1202776	hsa-miR-4661-3p	CLIP-seq
MIRT1202777	hsa-miR-4524	CLIP-seq
MIRT1202768	hsa-miR-1296	CLIP-seq
MIRT1202769	hsa-miR-3165	CLIP-seq
MIRT1202770	hsa-miR-3180	CLIP-seq
MIRT1202771	hsa-miR-3180-3p	CLIP-seq
MIRT1202772	hsa-miR-3190	CLIP-seq
MIRT1202773	hsa-miR-3196	CLIP-seq
MIRT1202774	hsa-miR-4512	CLIP-seq
MIRT1202768	hsa-miR-1296	CLIP-seq
MIRT1202769	hsa-miR-3165	CLIP-seq
MIRT1202770	hsa-miR-3180	CLIP-seq
MIRT1202771	hsa-miR-3180-3p	CLIP-seq
MIRT1202772	hsa-miR-3190	CLIP-seq
MIRT1202773	hsa-miR-3196	CLIP-seq
MIRT1202774	hsa-miR-4512	CLIP-seq
MIRT1202768	hsa-miR-1296	CLIP-seq
MIRT1202769	hsa-miR-3165	CLIP-seq
MIRT1202770	hsa-miR-3180	CLIP-seq
MIRT1202771	hsa-miR-3180-3p	CLIP-seq
MIRT1202772	hsa-miR-3190	CLIP-seq
MIRT1202773	hsa-miR-3196	CLIP-seq
MIRT1202774	hsa-miR-4512	CLIP-seq
MIRT2585112	hsa-miR-361-5p	CLIP-seq
MIRT2585113	hsa-miR-409-3p	CLIP-seq
MIRT2585114	hsa-miR-873	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
NFYA	Activation	14688259
NFYA	Unknown	17989114
TP53	Activation	16293709

Show/Hide all(54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	27251462
GO:0003677	Function	DNA binding	IDA	19506022
GO:0003684	Function	Damaged DNA binding	IDA	14706345
GO:0003684	Function	Damaged DNA binding	IEA
GO:0003684	Function	Damaged DNA binding	TAS	9223305
GO:0003824	Function	Catalytic activity	IEA
GO:0004519	Function	Endonuclease activity	TAS	9223305
GO:0005515	Function	Protein binding	IPI	15518571
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19506022
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	17148573
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS	9223305
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	IEA
GO:0006284	Process	Base-excision repair	IEA
GO:0006284	Process	Base-excision repair	TAS	9190902
GO:0006285	Process	Base-excision repair, AP site formation	IBA
GO:0006289	Process	Nucleotide-excision repair	IDA	19506022
GO:0006289	Process	Nucleotide-excision repair	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	8621488
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IGI	19506022
GO:0006979	Process	Response to oxidative stress	IDA	17148573
GO:0008017	Function	Microtubule binding	IEA
GO:0008534	Function	Oxidized purine nucleobase lesion DNA N-glycosylase activity	IEA
GO:0008534	Function	Oxidized purine nucleobase lesion DNA N-glycosylase activity	TAS	9190902
GO:0009314	Process	Response to radiation	IDA	17148573
GO:0016363	Component	Nuclear matrix	IDA	17148573
GO:0016363	Component	Nuclear matrix	IEA
GO:0016607	Component	Nuclear speck	IDA	17148573
GO:0016607	Component	Nuclear speck	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	27251462
GO:0032357	Function	Oxidized purine DNA binding	IDA	14706345
GO:0032991	Component	Protein-containing complex	IDA	19506022
GO:0034039	Function	8-oxo-7,8-dihydroguanine DNA N-glycosylase activity	IBA
GO:0034039	Function	8-oxo-7,8-dihydroguanine DNA N-glycosylase activity	IEA
GO:0034039	Function	8-oxo-7,8-dihydroguanine DNA N-glycosylase activity	IMP	10987279
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	27251462
GO:0044029	Process	Positive regulation of gene expression via chromosomal CpG island demethylation	IMP	27251462
GO:0045007	Process	Depurination	TAS
GO:0045008	Process	Depyrimidination	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	27251462
GO:0140078	Function	Class I DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA
GO:1901291	Process	Negative regulation of double-strand break repair via single-strand annealing	IDA	19506022

MIM	HGNC	e!Ensembl
601982	8125	ENSG00000114026

Protein

UniProt ID

O15527

Protein name

N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (AP lyase) (EC 4.2.99.18)]

Protein function

DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.

PDB

1EBM , 1FN7 , 1HU0 , 1KO9 , 1LWV , 1LWW , 1LWY , 1M3H , 1M3Q , 1N39 , 1N3A , 1N3C , 1YQK , 1YQL , 1YQM , 1YQR , 2I5W , 2NOB , 2NOE , 2NOF , 2NOH , 2NOI , 2NOL , 2NOZ , 2XHI , 3IH7 , 3KTU , 5AN4 , 6RLW , 6W0M , 6W0R , 6W13 , 7AYY , 8VWT , 8VWV , 8VX4 , 8VX6 , 9EOZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07934	OGG_N	25 → 141	8-oxoguanine DNA glycosylase, N-terminal domain	Family
PF00730	HhH-GPD	142 → 301	HhH-GPD superfamily base excision DNA repair protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
CILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG

Sequence length

345

Interactions

View interactions

	KEGG		Reactome
	Base excision repair		Recognition and association of DNA glycosylase with site containing an affected pyrimidine Cleavage of the damaged pyrimidine Recognition and association of DNA glycosylase with site containing an affected purine Cleavage of the damaged purine Displacement of DNA glycosylase by APEX1 APEX1-Independent Resolution of AP Sites via the Single Nucleotide Replacement Pathway Defective OGG1 Substrate Binding Defective OGG1 Substrate Processing Defective OGG1 Localization

OGG1 (8-oxoguanine DNA glycosylase)