Gene Gene information from NCBI Gene database.
Entrez ID 4948
Gene name OCA2 melanosomal transmembrane protein
Gene symbol OCA2
Synonyms (NCBI Gene)
BEYBEY1BEY2BOCAD15S12EYCLEYCL2EYCL3HCL3PPEDSHEP1SLC13B1
Chromosome 15
Chromosome location 15q12-q13.1
Summary This gene encodes the human homolog of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine, which is a precursor to melanin synthesis. It is
SNPs SNP information provided by dbSNP.
67
SNP ID Visualize variation Clinical significance Consequence
rs1800401 G>A Affects, likely-benign, benign Missense variant, non coding transcript variant, coding sequence variant
rs1800407 C>T Affects, likely-benign, benign Missense variant, non coding transcript variant, coding sequence variant
rs1800408 C>G Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, non coding transcript variant, coding sequence variant
rs61738394 C>G,T Likely-pathogenic, conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, missense variant, genic upstream transcript variant, upstream transcript variant
rs74653330 C>T Likely-benign, conflicting-interpretations-of-pathogenicity, benign Non coding transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
50
miRTarBase ID miRNA Experiments Reference
MIRT022272 hsa-miR-124-3p Microarray 18668037
MIRT047322 hsa-miR-181a-5p CLASH 23622248
MIRT446417 hsa-miR-6783-5p PAR-CLIP 22100165
MIRT446416 hsa-miR-1249-5p PAR-CLIP 22100165
MIRT446415 hsa-miR-6797-5p PAR-CLIP 22100165
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
HLTF Activation 22234890
LEF1 Activation 22234890
MITF Activation 22234890
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0005254 Function Chloride channel activity IDA 25513726
GO:0005515 Function Protein binding IPI 19116314
GO:0005765 Component Lysosomal membrane IDA 19116314
GO:0005789 Component Endoplasmic reticulum membrane IDA 19116314
GO:0006583 Process Melanin biosynthetic process from tyrosine IDA 25513726, 32966160
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611409 8101 ENSG00000104044
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q04671
Protein name P protein (Melanocyte-specific transporter protein) (Pink-eyed dilution protein homolog)
Protein function Contributes to a melanosome-specific anion (chloride) current that modulates melanosomal pH for optimal tyrosinase activity required for melanogenesis and the melanosome maturation (PubMed:11310796, PubMed:15262401, PubMed:22234890, PubMed:25513
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03600 CitMHS 342 775 Citrate transporter Family
Tissue specificity TISSUE SPECIFICITY: Expressed in melanocytes and retinal pigment epithelium. {ECO:0000269|PubMed:25513726, ECO:0000269|PubMed:32966160}.
Sequence
MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSS
WAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEF
ITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRCVQWLKV
MGLFAFVVLCSILFSLYPDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASG
PSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETV
SISIRASLQQTQAVPLLMAHQYLRGSVETQVTIATAILAGVYALIIFEIVHRTLAAMLGS
LAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVKAYRLSRG
RVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGA
ATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGICLVLLVCFPLLRLLYWNRKLYNKE
PSEIVELKHEIHVWRLTAQRISPASREETAVRRLLLGKVLALEHLLARRLHTFHRQISQE
DKNWETNIQELQKKHRISDGILLAKCLTVLGFVIFMFFLNSFVPGIHLDLGWIAILGAIW
LLILADIHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYVGEQTALLIKMVPEEQR
LIAAIVLVVWVSALASSLIDNIPFTATMIPVLLNLSHDPEVGLPAPPLMYALAFG
ACLGG
NGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCTVGMCYLLVAHVVVGWN
Sequence length 838
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Melanin biosynthesis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
678
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Albinism Likely pathogenic; Pathogenic rs141949212, rs1384042381 RCV000505060
RCV000504873
Albinism or congenital nystagmus Likely pathogenic; Pathogenic rs121918166, rs142988897 RCV004584136
RCV006261989
Brown oculocutaneous albinism Pathogenic rs1555375711 RCV000001003
Hypophosphatasia Pathogenic rs201791790 RCV004540683
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
- no classification for the single variant rs7495174, rs4778241 -
Cervical cancer Benign rs1800405 RCV005889695
Clear cell carcinoma of kidney Conflicting classifications of pathogenicity rs375281082 RCV005893350
Colon adenocarcinoma Benign rs1800405 RCV005889694
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Albinism Associate 29036293, 30414346, 33808351, 35328057, 37431738, 38279271, 39349469, 7762554
Albinism Ocular Associate 20806075, 21541274
Albinism Oculocutaneous Associate 20806075, 21541274, 22734612, 28266639, 31199599, 31345173, 33124154, 33800529, 34246199, 35328057, 35704304, 35870188, 36672876, 37431738, 37882226
View all (2 more)
Astigmatism Associate 30306274, 30747064
Borderline Personality Disorder Associate 25612291
Breast Neoplasms Associate 18284607
Brown Oculocutaneous Albinism Associate 11179026
Carcinoma Non Small Cell Lung Associate 18284607
Carcinoma Squamous Cell Associate 27424798, 28456133
Color Vision Defects Associate 17236130, 18252222, 18483556, 23548203, 23555287