Gene Gene information from NCBI Gene database.
Entrez ID 4924
Gene name Nucleobindin 1
Gene symbol NUCB1
Synonyms (NCBI Gene)
CALNUCNUC
Chromosome 19
Chromosome location 19q13.33
Summary This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. [provided by RefSeq, Jun 2010]
miRNA miRNA information provided by mirtarbase database.
357
miRTarBase ID miRNA Experiments Reference
MIRT005205 hsa-miR-30a-5p pSILAC 18668040
MIRT016302 hsa-miR-193b-3p Proteomics 21512034
MIRT016838 hsa-miR-335-5p Microarray 18185580
MIRT005205 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT048994 hsa-miR-92a-3p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
ATF6 Activation 17686766
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0001965 Function G-protein alpha-subunit binding ISS
GO:0003677 Function DNA binding IEA
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005085 Function Guanyl-nucleotide exchange factor activity ISS
GO:0005509 Function Calcium ion binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601323 8043 ENSG00000104805
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q02818
Protein name Nucleobindin-1 (CALNUC)
Protein function Major calcium-binding protein of the Golgi which may have a role in calcium homeostasis (By similarity). Acts as a non-receptor guanine nucleotide exchange factor which binds to and activates alpha subunits of guanine nucleotide-binding proteins
PDB 1SNL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13499 EF-hand_7 245 322 EF-hand domain pair Domain
Tissue specificity TISSUE SPECIFICITY: Expressed both in fetal and adult heart, lung, liver, kidney and brain, and in adult skeletal muscle, placenta and pancreas.
Sequence
MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVID
VLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMD
AEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYE
MLKEHERRRYLESLGEEQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDP
NRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHV
MKNVDTNQDRLVTLEEFLASTQ
RKEFGDTGEGWETVEMHPAYTEEELRRFEEELAAREAE
LNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL
KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
Sequence length 461
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Familial cancer of breast Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma of Lung Associate 19525928
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 21576635
★☆☆☆☆
Found in Text Mining only
Carcinoma Intraductal Noninfiltrating Inhibit 21576635
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Associate 37547718
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 17390015, 37547718
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 1 Associate 37576973
★☆☆☆☆
Found in Text Mining only
Diabetic Nephropathies Associate 36211816
★☆☆☆☆
Found in Text Mining only
Hypoxia Stimulate 19525928
★☆☆☆☆
Found in Text Mining only
Leukopenia Stimulate 37077532
★☆☆☆☆
Found in Text Mining only
Lupus Erythematosus Systemic Associate 20228543
★☆☆☆☆
Found in Text Mining only