Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4924
Gene name Gene Name - the full gene name approved by the HGNC.
Nucleobindin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NUCB1
Synonyms (NCBI Gene) Gene synonyms aliases
CALNUC, NUC
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. [provided by RefSeq, Jun 2010]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005205 hsa-miR-30a-5p pSILAC 18668040
MIRT016302 hsa-miR-193b-3p Proteomics 21512034
MIRT016838 hsa-miR-335-5p Microarray 18185580
MIRT005205 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT048994 hsa-miR-92a-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
ATF6 Activation 17686766
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001965 Function G-protein alpha-subunit binding ISS
GO:0003677 Function DNA binding IEA
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005085 Function Guanyl-nucleotide exchange factor activity ISS
GO:0005509 Function Calcium ion binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601323 8043 ENSG00000104805
Protein
UniProt ID Q02818
Protein name Nucleobindin-1 (CALNUC)
Protein function Major calcium-binding protein of the Golgi which may have a role in calcium homeostasis (By similarity). Acts as a non-receptor guanine nucleotide exchange factor which binds to and activates alpha subunits of guanine nucleotide-binding proteins
PDB 1SNL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13499 EF-hand_7 245 322 EF-hand domain pair Domain
Tissue specificity TISSUE SPECIFICITY: Expressed both in fetal and adult heart, lung, liver, kidney and brain, and in adult skeletal muscle, placenta and pancreas.
Sequence
MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVID
VLETDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMD
AEQDPNVQVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYE
MLKEHERRRYLESLGEEQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDP
NRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHV
MKNVDTNQDRLVTLEEFLASTQ
RKEFGDTGEGWETVEMHPAYTEEELRRFEEELAAREAE
LNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL
KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
Sequence length 461
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 19525928
Breast Neoplasms Associate 21576635
Carcinoma Intraductal Noninfiltrating Inhibit 21576635
Colonic Neoplasms Associate 37547718
Colorectal Neoplasms Associate 17390015, 37547718
Diabetes Mellitus Type 1 Associate 37576973
Diabetic Nephropathies Associate 36211816
Hypoxia Stimulate 19525928
Leukopenia Stimulate 37077532
Lupus Erythematosus Systemic Associate 20228543