Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4841
Gene name Gene Name - the full gene name approved by the HGNC.
Non-POU domain containing octamer binding
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NONO
Synonyms (NCBI Gene) Gene synonyms aliases
MRXS34, NMT55, NRB54, P54, P54NRB, PPP1R114
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MRXS34
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carc
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs869025343 G>A Pathogenic Synonymous variant, coding sequence variant
rs869025345 C>T Pathogenic Stop gained, coding sequence variant
rs876661316 G>T Pathogenic Splice donor variant
rs1057518476 TT>- Pathogenic Frameshift variant, coding sequence variant, 5 prime UTR variant
rs1057524408 C>T Pathogenic Coding sequence variant, stop gained, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022721 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT050934 hsa-miR-17-5p CLASH 23622248
MIRT048776 hsa-miR-93-5p CLASH 23622248
MIRT048042 hsa-miR-148a-3p CLASH 23622248
MIRT045567 hsa-miR-149-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IBA 21873635
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0001650 Component Fibrillar center IDA
GO:0002218 Process Activation of innate immune response IDA 28712728
GO:0003676 Function Nucleic acid binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300084 7871 ENSG00000147140
Protein
UniProt ID Q15233
Protein name Non-POU domain-containing octamer-binding protein (NonO protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit)
Protein function DNA- and RNA binding protein, involved in several nuclear processes (PubMed:11525732, PubMed:12403470, PubMed:26571461). Binds the conventional octamer sequence in double-stranded DNA (PubMed:11525732, PubMed:12403470, PubMed:26571461). Also bin
PDB 3SDE , 5IFM , 6WMZ , 7LRQ , 7LRU , 7PU5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 76 140 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 150 217 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF08075 NOPS 221 272 NOPS (NUC059) domain Domain
Tissue specificity TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines. {ECO:0000269|PubMed:9341872}.
Sequence
MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK
NFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRT
LAEIAKVELDNMPLRGKQLR
VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVI
VDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTT
FPRPVTVEPMDQLDDEEGLPEKL
VIKNQQFHKEREQPPRFAQPGSFEYEYAMRWK
ALIEMEKQQQDQVDRNIKEAREKLEMEM
EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQE
EMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM
PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Sequence length 471
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Apraxia Apraxia of Phonation rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
Cryptorchidism Bilateral Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay Gross motor development delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Unknown
Disease term Disease name Evidence References Source
Neurodevelopmental Disorders neurodevelopmental disorder GenCC
Associations from Text Mining
Disease Name Relationship Type References
Agenesis of Corpus Callosum Associate 39709004
ATR X syndrome Associate 27329731, 39709004
Autistic Disorder Associate 36653413
Breast Neoplasms Associate 11710964, 32576581, 32632453
Calcinosis Associate 29713041
Calcinosis Cutis Associate 32950106
Carcinogenesis Associate 29620226, 35013116
Carcinoma Hepatocellular Associate 33667716, 34079086, 34299096
Carcinoma Renal Cell Associate 33741027
Cardiomyopathies Associate 39709004