NMBR (neuromedin B receptor)

Gene

• Entrez ID: 4829
• Gene name: Neuromedin B receptor
• Gene symbol: NMBR
• Synonyms (NCBI Gene): BB1, BB1R, BRS1, NMB-R
• Chromosome: 6
• Chromosome location: 6q24.1
• Summary: This gene encodes a 7-transmembrane G protein-coupled receptor that binds neuromedin B, which is a growth factor and mitogen for gastrointestinal epithelial tissue and for normal and neoplastic lung. This receptor may play a role in smooth muscle contract

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004946	Function	Bombesin receptor activity	IEA
GO:0004946	Function	Bombesin receptor activity	TAS	7838118
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7838118, 8391296
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	1655761
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	7838118
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008188	Function	Neuropeptide receptor activity	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0031989	Process	Bombesin receptor signaling pathway	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IMP	31601264
GO:0032727	Process	Positive regulation of interferon-alpha production	IMP	31601264
GO:0090290	Process	Positive regulation of osteoclast proliferation	IEA
GO:0090290	Process	Positive regulation of osteoclast proliferation	ISS
GO:0140374	Process	Antiviral innate immune response	IEA
GO:0140374	Process	Antiviral innate immune response	IMP	31601264
GO:0160023	Process	Sneeze reflex	IEA
GO:0160023	Process	Sneeze reflex	ISS
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	IEA
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	ISS

Other IDs

• MIM: 162341
• HGNC: 7843
• e!Ensembl: ENSG00000135577

Protein

• UniProt ID: P28336
• Protein name: Neuromedin-B receptor (NMB-R) (Epididymis tissue protein Li 185a) (Neuromedin-B-preferring bombesin receptor)
• Protein function: Receptor for neuromedin-B (PubMed:1655761). Contributes to the maintenance of basal sigh rate through signaling in the pre-Botzinger complex, a cluster of several thousand neurons in the ventrolateral medulla responsible for inspiration during r
• PDB: 8H0P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	60 → 325	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in epididymis (at protein level). {ECO:0000269|PubMed:20736409}.
• Sequence:

  MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLG
  NIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIP
  VIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAV
  FSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLI
  KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSL
  GHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAV
  RMTSLKSNAKNMVTNSVLLNGHSMKQEMAL

• Sequence length: 390

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events

<