Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4826
Gene name Gene Name - the full gene name approved by the HGNC.	Neuronatin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NNAT
Synonyms (NCBI Gene) Gene synonyms aliases	Peg5
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found

Show/Hide all(64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054416	hsa-miR-198	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24519663
MIRT054416	hsa-miR-198	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24519663
MIRT054899	hsa-miR-708-5p	Luciferase reporter assay	23328481
MIRT054899	hsa-miR-708-5p	Luciferase reporter assay	23328481
MIRT054899	hsa-miR-708-5p	Luciferase reporter assay, qRT-PCR, Western blot	26075749
MIRT1188113	hsa-miR-1285	CLIP-seq
MIRT1188114	hsa-miR-149	CLIP-seq
MIRT1188115	hsa-miR-1539	CLIP-seq
MIRT1188116	hsa-miR-2277-3p	CLIP-seq
MIRT1188117	hsa-miR-2277-5p	CLIP-seq
MIRT1188118	hsa-miR-28-5p	CLIP-seq
MIRT1188119	hsa-miR-296-5p	CLIP-seq
MIRT1188120	hsa-miR-3074-5p	CLIP-seq
MIRT1188121	hsa-miR-3139	CLIP-seq
MIRT1188122	hsa-miR-3187-5p	CLIP-seq
MIRT1188123	hsa-miR-3193	CLIP-seq
MIRT1188124	hsa-miR-3202	CLIP-seq
MIRT1188125	hsa-miR-323-5p	CLIP-seq
MIRT1188126	hsa-miR-339-5p	CLIP-seq
MIRT1188127	hsa-miR-3667-3p	CLIP-seq
MIRT1188128	hsa-miR-3909	CLIP-seq
MIRT1188129	hsa-miR-4281	CLIP-seq
MIRT1188130	hsa-miR-4425	CLIP-seq
MIRT1188131	hsa-miR-4475	CLIP-seq
MIRT1188132	hsa-miR-4479	CLIP-seq
MIRT1188133	hsa-miR-4490	CLIP-seq
MIRT1188134	hsa-miR-4667-3p	CLIP-seq
MIRT1188135	hsa-miR-4667-5p	CLIP-seq
MIRT1188136	hsa-miR-4691-5p	CLIP-seq
MIRT1188137	hsa-miR-4700-5p	CLIP-seq
MIRT1188138	hsa-miR-4731-5p	CLIP-seq
MIRT1188139	hsa-miR-4747-5p	CLIP-seq
MIRT1188140	hsa-miR-4774-5p	CLIP-seq
MIRT1188141	hsa-miR-612	CLIP-seq
MIRT1188142	hsa-miR-665	CLIP-seq
MIRT1188143	hsa-miR-708	CLIP-seq
MIRT1188144	hsa-miR-892b	CLIP-seq
MIRT2054522	hsa-miR-19a	CLIP-seq
MIRT2054523	hsa-miR-19b	CLIP-seq
MIRT1188118	hsa-miR-28-5p	CLIP-seq
MIRT2054524	hsa-miR-3130-3p	CLIP-seq
MIRT1188121	hsa-miR-3139	CLIP-seq
MIRT1188128	hsa-miR-3909	CLIP-seq
MIRT2054525	hsa-miR-3936	CLIP-seq
MIRT1188136	hsa-miR-4691-5p	CLIP-seq
MIRT1188138	hsa-miR-4731-5p	CLIP-seq
MIRT2054526	hsa-miR-518a-5p	CLIP-seq
MIRT2054527	hsa-miR-527	CLIP-seq
MIRT1188142	hsa-miR-665	CLIP-seq
MIRT1188143	hsa-miR-708	CLIP-seq
MIRT1188118	hsa-miR-28-5p	CLIP-seq
MIRT1188121	hsa-miR-3139	CLIP-seq
MIRT1188128	hsa-miR-3909	CLIP-seq
MIRT1188136	hsa-miR-4691-5p	CLIP-seq
MIRT1188138	hsa-miR-4731-5p	CLIP-seq
MIRT1188142	hsa-miR-665	CLIP-seq
MIRT1188143	hsa-miR-708	CLIP-seq
MIRT1188118	hsa-miR-28-5p	CLIP-seq
MIRT1188121	hsa-miR-3139	CLIP-seq
MIRT1188128	hsa-miR-3909	CLIP-seq
MIRT1188136	hsa-miR-4691-5p	CLIP-seq
MIRT1188138	hsa-miR-4731-5p	CLIP-seq
MIRT1188142	hsa-miR-665	CLIP-seq
MIRT1188143	hsa-miR-708	CLIP-seq

Show/Hide all(4)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0007420	Process	Brain development	IBA	21873635
GO:0009249	Process	Protein lipoylation	TAS	8813377
GO:0032024	Process	Positive regulation of insulin secretion	IBA	21873635

MIM	HGNC	e!Ensembl
603106	7860	ENSG00000053438

Protein

UniProt ID

Q16517

Protein name

Neuronatin

Protein function

May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.

Family and domains

Sequence

MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL
AYTVSRTGRQVLGERRQRAPN

Sequence length

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	17043644
Neuroblastoma	Neuroblastoma	rs113994087, rs113994089, rs281864719, rs863225285, rs863225284, rs863225283, rs281864720, rs863225282, rs863225281, rs1057519698, rs915983602, rs1469271544	17762496

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	17805055
Adenocarcinoma of Lung	Associate	17805055
Anorexia Nervosa	Associate	37630847, 37987927
Breast Neoplasms	Inhibit	37400769
Carcinoma Non Small Cell Lung	Associate	17805055
Carcinoma Squamous Cell	Associate	17805055
Fetal Growth Retardation	Associate	19483473
Glioblastoma	Associate	22624064
Lafora Disease	Associate	23408434
Liposarcoma	Associate	24345474
Liposarcoma Myxoid	Associate	24345474
Multiple Endocrine Neoplasia Type 2a	Associate	28181547
Neoplasms	Associate	17805055, 22624064, 37400769
Neoplasms	Inhibit	24345474, 28181547
Neuroblastoma	Associate	39217334
Nijmegen Breakage Syndrome	Associate	35269426
Obesity	Inhibit	24158121
Obesity	Associate	37630847
Uterine Cervical Neoplasms	Associate	28351298
Wilms Tumor	Associate	12057921, 23825673

NNAT (neuronatin)