Gene Gene information from NCBI Gene database.
Entrez ID 4826
Gene name Neuronatin
Gene symbol NNAT
Synonyms (NCBI Gene)
Peg5
Chromosome 20
Chromosome location 20q11.23
Summary The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found
miRNA miRNA information provided by mirtarbase database.
64
miRTarBase ID miRNA Experiments Reference
MIRT054416 hsa-miR-198 ImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot 24519663
MIRT054416 hsa-miR-198 ImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot 24519663
MIRT054899 hsa-miR-708-5p Luciferase reporter assay 23328481
MIRT054899 hsa-miR-708-5p Luciferase reporter assay 23328481
MIRT054899 hsa-miR-708-5p Luciferase reporter assayqRT-PCRWestern blot 26075749
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0007420 Process Brain development IEA
GO:0007420 Process Brain development TAS 8813377
GO:0009249 Process Protein lipoylation TAS 8813377
GO:0032024 Process Positive regulation of insulin secretion IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603106 7860 ENSG00000053438
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16517
Protein name Neuronatin
Protein function May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.
Family and domains
Sequence
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL
AYTVSRTGRQVLGERRQRAPN
Sequence length 81
Interactions View interactions