Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4826
Gene name Gene Name - the full gene name approved by the HGNC.
Neuronatin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NNAT
Synonyms (NCBI Gene) Gene synonyms aliases
Peg5
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT054416 hsa-miR-198 Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24519663
MIRT054416 hsa-miR-198 Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24519663
MIRT054899 hsa-miR-708-5p Luciferase reporter assay 23328481
MIRT054899 hsa-miR-708-5p Luciferase reporter assay 23328481
MIRT054899 hsa-miR-708-5p Luciferase reporter assay, qRT-PCR, Western blot 26075749
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0007420 Process Brain development IEA
GO:0007420 Process Brain development TAS 8813377
GO:0009249 Process Protein lipoylation TAS 8813377
GO:0032024 Process Positive regulation of insulin secretion IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603106 7860 ENSG00000053438
Protein
UniProt ID Q16517
Protein name Neuronatin
Protein function May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.
Family and domains
Sequence
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKL
AYTVSRTGRQVLGERRQRAPN
Sequence length 81
Interactions View interactions
<