NFATC2 (nuclear factor of activated T cells 2)

Gene

• Entrez ID: 4773
• Gene name: Nuclear factor of activated T cells 2
• Gene symbol: NFATC2
• Synonyms (NCBI Gene): JCOSL, NFAT1, NFATP
• Chromosome: 20
• Chromosome location: 20q13.2
• Summary: This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only transloca

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005078	hsa-miR-184	Luciferase reporter assay, qRT-PCR, Western blot	19286996
MIRT623116	hsa-miR-8485	HITS-CLIP	23824327
MIRT640856	hsa-miR-603	HITS-CLIP	23824327
MIRT623115	hsa-miR-4700-3p	HITS-CLIP	23824327
MIRT623114	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT640855	hsa-miR-4459	HITS-CLIP	23824327
MIRT623113	hsa-miR-496	HITS-CLIP	23824327
MIRT623112	hsa-miR-3941	HITS-CLIP	23824327
MIRT623111	hsa-miR-4672	HITS-CLIP	23824327
MIRT623110	hsa-miR-466	HITS-CLIP	23824327
MIRT623116	hsa-miR-8485	HITS-CLIP	23824327
MIRT623115	hsa-miR-4700-3p	HITS-CLIP	23824327
MIRT623114	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT623113	hsa-miR-496	HITS-CLIP	23824327
MIRT623112	hsa-miR-3941	HITS-CLIP	23824327
MIRT623111	hsa-miR-4672	HITS-CLIP	23824327
MIRT623110	hsa-miR-466	HITS-CLIP	23824327
MIRT616545	hsa-miR-10a-3p	HITS-CLIP	23824327
MIRT616544	hsa-miR-1183	HITS-CLIP	23824327
MIRT616543	hsa-miR-6760-3p	HITS-CLIP	23824327
MIRT616542	hsa-miR-1208	HITS-CLIP	23824327
MIRT616541	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT616540	hsa-miR-20b-3p	HITS-CLIP	23824327
MIRT616539	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT616538	hsa-miR-4512	HITS-CLIP	23824327
MIRT445809	hsa-miR-5571-5p	PAR-CLIP	22100165
MIRT445808	hsa-miR-451b	PAR-CLIP	22100165
MIRT445807	hsa-miR-4310	PAR-CLIP	22100165
MIRT445806	hsa-miR-7157-5p	PAR-CLIP	22100165
MIRT445805	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT616545	hsa-miR-10a-3p	HITS-CLIP	27418678
MIRT616542	hsa-miR-1208	HITS-CLIP	27418678
MIRT616541	hsa-miR-1304-3p	HITS-CLIP	27418678
MIRT616539	hsa-miR-3157-5p	HITS-CLIP	27418678
MIRT616538	hsa-miR-4512	HITS-CLIP	27418678
MIRT616543	hsa-miR-6760-3p	HITS-CLIP	27418678
MIRT733508	hsa-miR-1270	qRT-PCR	34150008
MIRT623116	hsa-miR-8485	HITS-CLIP	23824327
MIRT640856	hsa-miR-603	HITS-CLIP	23824327
MIRT623115	hsa-miR-4700-3p	HITS-CLIP	23824327
MIRT623114	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT640855	hsa-miR-4459	HITS-CLIP	23824327
MIRT623113	hsa-miR-496	HITS-CLIP	23824327
MIRT623112	hsa-miR-3941	HITS-CLIP	23824327
MIRT623111	hsa-miR-4672	HITS-CLIP	23824327
MIRT623110	hsa-miR-466	HITS-CLIP	23824327
MIRT623116	hsa-miR-8485	HITS-CLIP	23824327
MIRT623115	hsa-miR-4700-3p	HITS-CLIP	23824327
MIRT623114	hsa-miR-6504-3p	HITS-CLIP	23824327
MIRT623113	hsa-miR-496	HITS-CLIP	23824327
MIRT623112	hsa-miR-3941	HITS-CLIP	23824327
MIRT623111	hsa-miR-4672	HITS-CLIP	23824327
MIRT623110	hsa-miR-466	HITS-CLIP	23824327
MIRT616545	hsa-miR-10a-3p	HITS-CLIP	23824327
MIRT616544	hsa-miR-1183	HITS-CLIP	23824327
MIRT616543	hsa-miR-6760-3p	HITS-CLIP	23824327
MIRT616542	hsa-miR-1208	HITS-CLIP	23824327
MIRT616541	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT616540	hsa-miR-20b-3p	HITS-CLIP	23824327
MIRT616539	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT616538	hsa-miR-4512	HITS-CLIP	23824327
MIRT445809	hsa-miR-5571-5p	PAR-CLIP	22100165
MIRT445808	hsa-miR-451b	PAR-CLIP	22100165
MIRT445807	hsa-miR-4310	PAR-CLIP	22100165
MIRT445806	hsa-miR-7157-5p	PAR-CLIP	22100165
MIRT445805	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT1182146	hsa-miR-3184	CLIP-seq
MIRT1182147	hsa-miR-423-5p	CLIP-seq
MIRT1182148	hsa-miR-431	CLIP-seq
MIRT1182149	hsa-miR-4675	CLIP-seq
MIRT1182150	hsa-miR-4710	CLIP-seq
MIRT1182151	hsa-miR-4711-3p	CLIP-seq
MIRT1182152	hsa-miR-4721	CLIP-seq
MIRT1182153	hsa-miR-4741	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	8668213
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8668213
GO:0005515	Function	Protein binding	IPI	16873067, 17377532, 18218901, 19505873, 20557936, 21458306, 21983832, 23105117, 24561192, 24954618, 25609649
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12370307, 12656674
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8668213
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IDA	12656674
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8668213
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	8668213
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	9510247
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006974	Process	DNA damage response	IMP	17875758
GO:0009410	Process	Response to xenobiotic stimulus	IMP	17875758
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0014904	Process	Myotube cell development	IEA
GO:0016477	Process	Cell migration	IDA	21871017
GO:0019902	Function	Phosphatase binding	IPI	26248042
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	17875758
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IBA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IPI	9510247
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15790681
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050853	Process	B cell receptor signaling pathway	IMP	17875758
GO:0051216	Process	Cartilage development	IEA
GO:0051216	Process	Cartilage development	IMP	35789258
GO:0060090	Function	Molecular adaptor activity	EXP	29432148
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0071889	Function	14-3-3 protein binding	EXP	29432148
GO:0140742	Process	LncRNA transcription	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	IEA
GO:1905064	Process	Negative regulation of vascular associated smooth muscle cell differentiation	IDA	23853098
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 600490
• HGNC: 7776
• e!Ensembl: ENSG00000101096

Protein

• UniProt ID: Q13469
• Protein name: Nuclear factor of activated T-cells, cytoplasmic 2 (NF-ATc2) (NFATc2) (NFAT pre-existing subunit) (NF-ATp) (T-cell transcription factor NFAT1)
• Protein function: Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF (PubMed:15790681). Promotes invasive migration through the activation of GPC6 expression and WNT5A si
• PDB: 1A02, 1OWR, 1P7H, 1PZU, 1S9K, 2AS5, 2O93, 3QRF, 8OW4, 8R07, 8R3F
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00554	RHD_DNA_bind	410 → 570	Rel homology DNA-binding domain	Domain
  PF16179	RHD_dimer	579 → 679	Rel homology dimerisation domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Isoform 1 is highly expressed in the small intestine, heart, testis, prostate, thymus, placenta and thyroid. Isoform 3 is highly expressed in stomach, ut
• Sequence:

  MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAY
  PDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHE
  LIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS
  DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPR
  PASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS
  AVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGER
  RNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH
  RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRIT
  GKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNT
  RVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTG
  QNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYV
  INGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC
  LVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADA
  HRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG
  TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNL
  DQTYLDDVNEIIRKEFSGPPARNQT

• Sequence length: 925

Pathways

KEGG:

Calcium signaling pathway
cGMP-PKG signaling pathway
Efferocytosis
Cellular senescence
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Oxytocin signaling pathway
Yersinia infection
Hepatitis B
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis

Reactome:

Calcineurin activates NFAT
FCERI mediated Ca+2 mobilization
CLEC7A (Dectin-1) induces NFAT activation
RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)

Associated diseases

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Dilated cardiomyopathy 1A	Likely pathogenic	rs377609235	RCV002259538
Joint contractures, osteochondromas, and B-cell lymphoma	Pathogenic	rs2515685116	RCV003152453

Associations from Text Mining
Disease Name	Relationship Type	References
Accessory Nerve Injuries	Stimulate	35892263
Adenocarcinoma	Stimulate	21192845
Adenocarcinoma of Lung	Associate	34257525
Anemia Aplastic	Associate	17463169
Arthritis Rheumatoid	Associate	25376468
Asthma	Stimulate	33079489
Bone Cysts	Associate	34081036
Bone Neoplasms	Associate	24993903, 32327700, 34310785
Brain Ischemia	Associate	22363514
Breast Neoplasms	Associate	16880514, 21964595, 27809618, 35265226, 37399784, 40496857
Burkitt Lymphoma	Associate	12594826, 35472072
Carcinogenesis	Associate	28504924
Carcinoma Hepatocellular	Associate	22787160, 27458175, 31181320, 33023539, 33754043
Carcinoma Non Small Cell Lung	Associate	21192845, 34257525
Carcinoma Pancreatic Ductal	Associate	25299780
Carcinoma Squamous Cell	Associate	34257525
Carcinosarcoma	Associate	25918253
Cholangiocarcinoma	Stimulate	37285922
Chondrosarcoma Mesenchymal	Associate	32327700
Colonic Neoplasms	Associate	15632146
Colorectal Neoplasms	Associate	26795951, 28504924
Contracture	Associate	35789258
Coronary Artery Disease	Inhibit	32183825
Cytomegalovirus Infections	Associate	27327144
Diabetes Mellitus Type 1	Inhibit	22332874
Diabetic Nephropathies	Associate	35885938
Down Syndrome	Associate	23830204
Drug Hypersensitivity	Associate	25987655
Drug Hypersensitivity	Stimulate	33079489
Edema	Associate	20628086
End Stage Liver Disease	Inhibit	29054923
Eosinophilia	Associate	33079489
Fibrous Dysplasia Polyostotic	Associate	34310785
Giant Cell Tumor of Bone	Associate	24993903
Glioblastoma	Associate	23762456, 24130787
Glioma	Associate	37452092
Gout	Associate	31738005
Heart Diseases	Associate	24486774
Heart Failure	Associate	22363514
Hemangioma	Associate	34081036
Hypereosinophilic Syndrome	Associate	16219537
Hypersensitivity Immediate	Associate	12594826
Hypoxia	Stimulate	29426911
Immune Reconstitution Inflammatory Syndrome	Stimulate	28316373
Immunoglobulin Light chain Amyloidosis	Associate	32922167
Intervertebral Disc Degeneration	Associate	40561275
Leukemia Lymphocytic Chronic B Cell	Associate	23936412
Liposarcoma Myxoid	Associate	30895378, 32362012
Lupus Erythematosus Systemic	Stimulate	17237447
Lupus Erythematosus Systemic	Associate	20506525, 25225673
Lymphoma B Cell	Associate	35789258
Lymphoma T Cell Peripheral	Associate	23716562
Melanoma	Associate	22718120
Melanoma	Stimulate	30459241
Mucocutaneous Lymph Node Syndrome	Stimulate	32183825
Mucocutaneous Lymph Node Syndrome	Associate	36779231, 36974504
Multiple Myeloma	Associate	32922167
Multiple Sclerosis	Associate	31170158, 34584155
Myopathies Structural Congenital	Stimulate	30459241
Narcolepsy	Associate	26333835, 32358372, 32669953
Nasopharyngeal Carcinoma	Associate	30772768
Neoplasm Metastasis	Associate	21964595, 30772768
Neoplasm Metastasis	Stimulate	30459241, 37285922
Neoplasms	Associate	21192845, 22787160, 23762456, 26795951, 30459241, 31659097, 32327700, 32362012, 34081036, 36555836, 37285922, 37452092, 38035702
Neoplasms	Stimulate	28504924
Neoplasms	Inhibit	33023539
Neuralgia	Associate	35892263
Neutropenia	Associate	19344427
Osteochondroma	Associate	35789258
Pancreatic Neoplasms	Associate	28774282, 30696421, 38035702
Periodic fever familial autosomal dominant	Associate	30696421
Personality Disorders	Inhibit	33023539
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	25987655
Pulmonary Disease Chronic Obstructive	Stimulate	23905758
Renal cell carcinoma 1	Associate	35789258
Renal Insufficiency	Associate	32123936
Sarcoidosis	Inhibit	21177920
Sarcoidosis	Associate	22984568
Sarcoma	Associate	31972596, 32327700, 36232302, 36555836
Sarcoma Ewing	Associate	24993903, 28643791, 30895378
Sarcoma Small Cell	Associate	34081036
Spinal Cord Injuries	Associate	36842142
Squamous Cell Carcinoma of Head and Neck	Associate	27035117
Status Asthmaticus	Stimulate	33079489
Tetralogy of Fallot	Associate	24479926
Vascular Malformations	Associate	34081036