Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4713
Gene name Gene Name - the full gene name approved by the HGNC.
NADH:ubiquinone oxidoreductase subunit B7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NDUFB7
Synonyms (NCBI Gene) Gene synonyms aliases
B18, CI-B18, MC1DN39
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005739 Component Mitochondrion HDA 20833797
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IDA 28844695
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603842 7702 ENSG00000099795
Protein
UniProt ID P17568
Protein name NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (Cell adhesion protein SQM1) (Complex I-B18) (CI-B18) (NADH-ubiquinone oxidoreductase B18 subunit)
Protein function Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat
PDB 5XTC , 5XTD , 5XTH , 5XTI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05676 NDUF_B7 40 102 NADH-ubiquinone oxidoreductase B18 subunit (NDUFB7) Family
Sequence
MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCA
HHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEF
ERERRLLQRKKRREKKAA
ELAKGQGPGEVDPKVAL
Sequence length 137
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy
  Respiratory electron transport
Complex I biogenesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Mitochondrial Complex Deficiency mitochondrial complex I deficiency, nuclear type 39 N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anemia Hemolytic Stimulate 856385
Anemia Pernicious Associate 856385
Arthritis Psoriatic Associate 34344401
Autoimmune Diseases Associate 21628452
Breast Neoplasms Associate 26289852
Diabetes Mellitus Associate 3578273
Diabetes Mellitus Stimulate 6746903
Diabetes Mellitus Type 1 Associate 21628452, 3578273, 990715
Diabetes Mellitus Type 1 Stimulate 6594040
Endocrine System Diseases Stimulate 856385