Gene Gene information from NCBI Gene database.
Entrez ID 4698
Gene name NADH:ubiquinone oxidoreductase subunit A5
Gene symbol NDUFA5
Synonyms (NCBI Gene)
B13CI-13KD-BCI-13kBNUFMUQOR13
Chromosome 7
Chromosome location 7q31.32
Summary This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons fr
miRNA miRNA information provided by mirtarbase database.
588
miRTarBase ID miRNA Experiments Reference
MIRT029848 hsa-miR-26b-5p Microarray 19088304
MIRT049589 hsa-miR-92a-3p CLASH 23622248
MIRT036522 hsa-miR-1226-3p CLASH 23622248
MIRT539799 hsa-miR-8485 HITS-CLIP 21572407
MIRT539798 hsa-miR-4789-5p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24344204, 27499296, 28514442, 32296183, 32814053, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IDA 28844695
GO:0005743 Component Mitochondrial inner membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601677 7688 ENSG00000128609
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16718
Protein name NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (Complex I subunit B13) (Complex I-13kD-B) (CI-13kD-B) (NADH-ubiquinone oxidoreductase 13 kDa-B subunit)
Protein function Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat
PDB 5XTB , 5XTD , 5XTH , 5XTI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04716 ETC_C1_NDUFA5 13 79 ETC complex I subunit conserved region Family
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined with highest levels in heart, skeletal muscle and brain. {ECO:0000269|PubMed:9048877}.
Sequence
MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVK
AEPDVKKLEDQLQGGQLEE
VILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Sequence length 116
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy
  Respiratory electron transport
Complex I biogenesis