Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4698
Gene name Gene Name - the full gene name approved by the HGNC.
NADH:ubiquinone oxidoreductase subunit A5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NDUFA5
Synonyms (NCBI Gene) Gene synonyms aliases
B13, CI-13KD-B, CI-13kB, NUFM, UQOR13
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q31.32
Summary Summary of gene provided in NCBI Entrez Gene.
This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons fr
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029848 hsa-miR-26b-5p Microarray 19088304
MIRT049589 hsa-miR-92a-3p CLASH 23622248
MIRT036522 hsa-miR-1226-3p CLASH 23622248
MIRT539799 hsa-miR-8485 HITS-CLIP 21572407
MIRT539798 hsa-miR-4789-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24344204, 27499296, 28514442, 32296183, 32814053, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IDA 28844695
GO:0005743 Component Mitochondrial inner membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601677 7688 ENSG00000128609
Protein
UniProt ID Q16718
Protein name NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 (Complex I subunit B13) (Complex I-13kD-B) (CI-13kD-B) (NADH-ubiquinone oxidoreductase 13 kDa-B subunit)
Protein function Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat
PDB 5XTB , 5XTD , 5XTH , 5XTI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04716 ETC_C1_NDUFA5 13 79 ETC complex I subunit conserved region Family
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined with highest levels in heart, skeletal muscle and brain. {ECO:0000269|PubMed:9048877}.
Sequence
MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVK
AEPDVKKLEDQLQGGQLEE
VILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Sequence length 116
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy
  Respiratory electron transport
Complex I biogenesis
<