Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4692
Gene name	Necdin, MAGE family member
Gene symbol	NDN
Synonyms (NCBI Gene)	HsT16328PWCR
Chromosome	15
Chromosome location	15q11.2
Summary	This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic

Show/Hide all (54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019333	hsa-miR-148b-3p	Microarray	17612493
MIRT2280570	hsa-miR-4798-3p	CLIP-seq
MIRT2280571	hsa-miR-561	CLIP-seq
MIRT2438958	hsa-miR-145	CLIP-seq
MIRT2438959	hsa-miR-3591-5p	CLIP-seq
MIRT2438960	hsa-miR-3671	CLIP-seq
MIRT2438961	hsa-miR-4280	CLIP-seq
MIRT2438962	hsa-miR-455-3p	CLIP-seq
MIRT2438963	hsa-miR-4786-5p	CLIP-seq
MIRT2438964	hsa-miR-607	CLIP-seq
MIRT2438965	hsa-miR-769-5p	CLIP-seq
MIRT2579054	hsa-miR-1295	CLIP-seq
MIRT2438958	hsa-miR-145	CLIP-seq
MIRT2579055	hsa-miR-3145-5p	CLIP-seq
MIRT2579056	hsa-miR-3179	CLIP-seq
MIRT2438959	hsa-miR-3591-5p	CLIP-seq
MIRT2438960	hsa-miR-3671	CLIP-seq
MIRT2579057	hsa-miR-3692	CLIP-seq
MIRT2579058	hsa-miR-3974	CLIP-seq
MIRT2438961	hsa-miR-4280	CLIP-seq
MIRT2579059	hsa-miR-4299	CLIP-seq
MIRT2579060	hsa-miR-4512	CLIP-seq
MIRT2438962	hsa-miR-455-3p	CLIP-seq
MIRT2579061	hsa-miR-4652-3p	CLIP-seq
MIRT2579062	hsa-miR-4710	CLIP-seq
MIRT2438963	hsa-miR-4786-5p	CLIP-seq
MIRT2579063	hsa-miR-4792	CLIP-seq
MIRT2579064	hsa-miR-508-5p	CLIP-seq
MIRT2579065	hsa-miR-578	CLIP-seq
MIRT2438964	hsa-miR-607	CLIP-seq
MIRT2579066	hsa-miR-609	CLIP-seq
MIRT2438965	hsa-miR-769-5p	CLIP-seq
MIRT2579054	hsa-miR-1295	CLIP-seq
MIRT2686014	hsa-miR-138	CLIP-seq
MIRT2438958	hsa-miR-145	CLIP-seq
MIRT2579055	hsa-miR-3145-5p	CLIP-seq
MIRT2686015	hsa-miR-3164	CLIP-seq
MIRT2579056	hsa-miR-3179	CLIP-seq
MIRT2438959	hsa-miR-3591-5p	CLIP-seq
MIRT2438960	hsa-miR-3671	CLIP-seq
MIRT2579058	hsa-miR-3974	CLIP-seq
MIRT2438961	hsa-miR-4280	CLIP-seq
MIRT2579059	hsa-miR-4299	CLIP-seq
MIRT2579060	hsa-miR-4512	CLIP-seq
MIRT2438962	hsa-miR-455-3p	CLIP-seq
MIRT2579061	hsa-miR-4652-3p	CLIP-seq
MIRT2686016	hsa-miR-4778-3p	CLIP-seq
MIRT2438963	hsa-miR-4786-5p	CLIP-seq
MIRT2579064	hsa-miR-508-5p	CLIP-seq
MIRT2579065	hsa-miR-578	CLIP-seq
MIRT2438964	hsa-miR-607	CLIP-seq
MIRT2579066	hsa-miR-609	CLIP-seq
MIRT2686017	hsa-miR-617	CLIP-seq
MIRT2438965	hsa-miR-769-5p	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0003016	Process	Respiratory system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21364888, 24722188, 32529326, 32814053, 34591642
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0008347	Process	Glial cell migration	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043015	Function	Gamma-tubulin binding	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IEA
GO:0048666	Process	Neuron development	IEA
GO:0048675	Process	Axon extension	IEA
GO:0048871	Process	Multicellular organismal-level homeostasis	IEA
GO:0071514	Process	Genomic imprinting	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
602117	7675	ENSG00000182636

Q99608

Protein name

Necdin

Protein function

Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle-promoting proteins such as SV40 large T antigen, adenovirus

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01454	MAGE	157 → 273	MAGE family	Family

Tissue specificity

TISSUE SPECIFICITY: Almost ubiquitous. Detected in fetal brain, lung, liver and kidney; in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Not detected in pe

Sequence

MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQA
PNDEGDPKALQQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIW
FPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVA
LSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTFGDVRKLITEEFV
QMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEE
ARALREANPTAHYPRSSVSED

Sequence length

321

Interactions

View interactions

	Reactome
			Interleukin-4 and Interleukin-13 signaling

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
NDN-related disorder	Likely benign	rs774758735, rs747112236	RCV003964630 RCV003951355
Prader-Willi syndrome	Uncertain significance	rs2140756886, rs1555376130, rs1891151702, rs1891161078	RCV001843860 RCV000662114 RCV001196772 RCV001196147

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	34252262
Autistic Disorder	Associate	18835857
Breast Neoplasms	Inhibit	22046235
Endometrial Neoplasms	Associate	32170852
Esophageal Squamous Cell Carcinoma	Associate	12901795
Glioblastoma	Inhibit	21525872
Inflammation	Associate	32330594
Insulin Resistance	Associate	22138333
Melanoma	Inhibit	22046235
Neoplasms	Associate	10347180, 22691188, 23549060, 32330594
Neoplasms	Inhibit	18644980, 22046235
Neuroblastoma	Associate	39217334
Obesity	Associate	21233802
Obesity	Inhibit	27158277
Ovarian Neoplasms	Inhibit	22046235
Ovarian Neoplasms	Associate	23549060
Overweight	Associate	27158277
Paranoid Disorders	Associate	29343559
Prader Willi Syndrome	Associate	15247330, 21233802, 29343559, 30102380, 32480405, 35688807
Pre Eclampsia	Inhibit	33003346
Prostatic Neoplasms	Associate	24513574
Schaaf Yang syndrome	Associate	18835857
Schizophrenia	Associate	29343559
Squamous Cell Carcinoma of Head and Neck	Associate	26518708
Urethral Neoplasms	Inhibit	18644980, 23549060
Weight Loss	Associate	22138333

NDN (necdin, MAGE family member)