Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4646
Gene name Gene Name - the full gene name approved by the HGNC.
Myosin VI
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYO6
Synonyms (NCBI Gene) Gene synonyms aliases
DFNA22, DFNB37
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q14.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a reverse-direction motor protein that moves toward the minus end of actin filaments and plays a role in intracellular vesicle and organelle transport. The protein consists of a motor domain containing an ATP- and an actin-binding site a
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121912557 G>A Pathogenic Genic downstream transcript variant, non coding transcript variant, missense variant, coding sequence variant
rs121912558 C>T Pathogenic Genic downstream transcript variant, non coding transcript variant, stop gained, coding sequence variant
rs121912560 A>G Likely-pathogenic, pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs121912561 C>T Pathogenic Genic downstream transcript variant, non coding transcript variant, stop gained, coding sequence variant
rs139664153 G>A Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, non coding transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000458 hsa-miR-143-3p qRT-PCR, Luciferase reporter assay, Western blot 20353999
MIRT000457 hsa-miR-145-5p qRT-PCR, Luciferase reporter assay, Western blot 20353999
MIRT018339 hsa-miR-335-5p Microarray 18185580
MIRT020824 hsa-miR-155-5p Proteomics 18668040
MIRT000458 hsa-miR-143-3p Western blot 19843160
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000146 Function Microfilament motor activity IBA
GO:0000166 Function Nucleotide binding IEA
GO:0001726 Component Ruffle IBA
GO:0001726 Component Ruffle IDA 9852149, 16507995
GO:0003774 Function Cytoskeletal motor activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600970 7605 ENSG00000196586
Protein
UniProt ID Q9UM54
Protein name Unconventional myosin-VI (Unconventional myosin-6)
Protein function Myosins are actin-based motor molecules with ATPase activity (By similarity). Unconventional myosins serve in intracellular movements (By similarity). Myosin 6 is a reverse-direction motor protein that moves towards the minus-end of actin filame
PDB 2N0Z , 2N10 , 2N11 , 2N12 , 2N13 , 6E5N , 6J56 , 8W41
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00063 Myosin_head 59 759 Myosin head (motor domain) Domain
PF16521 Myosin-VI_CBD 1177 1267 Myosin VI cargo binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in most tissues examined including heart, brain, placenta, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Highest levels in brain, pancreas, testis and small intestine. Also expressed in fetal b
Sequence
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVE
DNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSL
GTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDD
RIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGK
EERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEY
LKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSG
GCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNAR
DALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKL
QQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSD
QHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDA
LHMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRS
TGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKK
YMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFR
PGKFAEFDQIMKSDPDHLAEL
VKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGL
VKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYD
ALVKSSEELLSALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEM
EAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQQQAVLEQERRDRELALRIAQSE
AELISDEAQADLALRRSLDSYPVSKNDGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAG
TKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAP
KSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKG
WWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEE
IWERCGG
IQYLQNAIESRQARPTYATAMLQSLLK
Sequence length 1294
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Motor proteins
Pathogenic Escherichia coli infection
Salmonella infection
  Gap junction degradation
Trafficking of AMPA receptors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Deafness Autosomal dominant nonsyndromic hearing loss 22, Autosomal recessive nonsyndromic hearing loss 37 rs878853225, rs1057523846, rs1060499799, rs121912557, rs1562201376, rs551348450, rs121912558, rs121912561, rs1562283089, rs1554218566, rs727504567, rs1582024232, rs876657653 N/A
Junctional Epidermolysis Bullosa With Pyloric Atresia junctional epidermolysis bullosa with pyloric atresia rs551348450 N/A
Tremor essential tremor rs551348450 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
hearing impairment Hearing impairment N/A N/A ClinVar
Hearing Loss Hearing loss, autosomal recessive N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37965333
Atrial Septal Defect Sinus Venosus Associate 29969989
Cardiomyopathy Hypertrophic Associate 16507995, 29969989
Ciliopathies Associate 34957672
Colorectal Neoplasms Associate 27044563, 32993655, 35091088
Deafness Associate 12687499, 23767834, 24105371, 27344577, 27474411, 32048449, 34997062, 35248088, 37872146
Deafness autosomal dominant nonsyndromic sensorineural 22 Associate 12687499, 27474411
Deafness Autosomal Recessive Associate 12687499
Deafness Autosomal Recessive 37 Associate 27474411
Delayed Cranial Ossification due to CBFB Haploinsufficiency Associate 20648052