MYCL (MYCL proto-oncogene, bHLH transcription factor)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 4610
Gene name MYCL proto-oncogene, bHLH transcription factor
Gene symbol MYCL
Synonyms (NCBI Gene)
L-MycLMYCMYCL1bHLHe38
Chromosome 1
Chromosome location 1p34.2
miRNA miRNA information provided by mirtarbase database.
10
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (10)
miRTarBase ID miRNA Experiments Reference
MIRT640804 hsa-miR-4506 HITS-CLIP 23824327
MIRT640803 hsa-miR-4328 HITS-CLIP 23824327
MIRT640802 hsa-miR-569 HITS-CLIP 23824327
MIRT640801 hsa-miR-2053 HITS-CLIP 23824327
MIRT439153 hsa-let-7c-5p 3'LIFE 25074381
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
164850 7555 ENSG00000116990
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P12524
Protein name Protein L-Myc (Class E basic helix-loop-helix protein 38) (bHLHe38) (Protein L-Myc-1) (V-myc myelocytomatosis viral oncogene homolog)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01056 Myc_N 1 → 161 Myc amino-terminal region Family
PF01056 Myc_N 143 → 237 Myc amino-terminal region Family
PF00010 HLH 282 → 334 Helix-loop-helix DNA-binding domain Domain
Sequence 
MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGP
PEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRG
NPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSENEEIDVVTVEKRQS
LGIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQEEASERGPQEEVLER
DAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSR
FLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAY
LTGY
Sequence length 364
Interactions View interactions