MYCL (MYCL proto-oncogene, bHLH transcription factor)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4610
Gene name Gene Name - the full gene name approved by the HGNC.
MYCL proto-oncogene, bHLH transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYCL
Synonyms (NCBI Gene) Gene synonyms aliases
L-Myc, LMYC, MYCL1, bHLHe38
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT640804 hsa-miR-4506 HITS-CLIP 23824327
MIRT640803 hsa-miR-4328 HITS-CLIP 23824327
MIRT640802 hsa-miR-569 HITS-CLIP 23824327
MIRT640801 hsa-miR-2053 HITS-CLIP 23824327
MIRT439153 hsa-let-7c-5p 3'LIFE 25074381
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
164850 7555 ENSG00000116990
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID P12524
Protein name Protein L-Myc (Class E basic helix-loop-helix protein 38) (bHLHe38) (Protein L-Myc-1) (V-myc myelocytomatosis viral oncogene homolog)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01056 Myc_N 1 → 161 Myc amino-terminal region Family
PF01056 Myc_N 143 → 237 Myc amino-terminal region Family
PF00010 HLH 282 → 334 Helix-loop-helix DNA-binding domain Domain
Sequence 
MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGP
PEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRG
NPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSENEEIDVVTVEKRQS
LGIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQEEASERGPQEEVLER
DAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSR
FLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAY
LTGY
Sequence length 364
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Show/Hide Text Mining Associations (58)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 1973618
Breast Neoplasms Associate 12456990, 25390939, 36404592
Calcinosis Cutis Associate 2895475
Carcinogenesis Associate 1486864, 29028833
Carcinoid Tumor Associate 38237798
Carcinoma Large Cell Associate 26960398, 38237798
Carcinoma Merkel Cell Associate 19020549, 27880818, 29028833, 34593967, 35688945, 35775490
Carcinoma Neuroendocrine Associate 35608806, 36694106
Carcinoma Non Small Cell Lung Associate 1690210, 8980399
Carcinoma Small Cell Associate 27764802