Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4440
Gene name Gene Name - the full gene name approved by the HGNC.
Musashi RNA binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MSI1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlat
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052295 hsa-let-7b-5p CLASH 23622248
MIRT048066 hsa-miR-197-3p CLASH 23622248
MIRT649997 hsa-miR-501-3p HITS-CLIP 23824327
MIRT649996 hsa-miR-502-3p HITS-CLIP 23824327
MIRT649995 hsa-miR-4719 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IEA
GO:0003723 Function RNA binding TAS 9790759
GO:0003727 Function Single-stranded RNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603328 7330 ENSG00000135097
Protein
UniProt ID O43347
Protein name RNA-binding protein Musashi homolog 1 (Musashi-1)
Protein function RNA binding protein that regulates the expression of target mRNAs at the translation level. Regulates expression of the NOTCH1 antagonist NUMB. Binds RNA containing the sequence 5'-GUUAGUUAGUUAGUU-3' and other sequences containing the pattern 5'
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 22 91 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 111 180 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Detected in fetal kidney, brain, liver and lung, and in adult brain and pancreas. Detected in hepatoma cell lines. {ECO:0000269|PubMed:12054577, ECO:0000269|PubMed:9790759}.
Sequence
METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRS
RGFGFVTFMDQAGVDKVLAQSRHELDSKTID
PKVAFPRRAQPKMVTRTKKIFVGGLSVNT
TVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE

CKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYT
YQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGST
PSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNG
YH
Sequence length 362
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  mRNA surveillance pathway  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Microcephaly microcephaly N/A N/A GenCC
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 20305619, 22012766
Adenocarcinoma Clear Cell Stimulate 25971681
Adenocarcinoma Mucinous Stimulate 25971681
Adenomyosis Associate 39595532
Alzheimer Disease Associate 30367664
Barrett Esophagus Associate 21916995
Brain Neoplasms Associate 18826648, 33120728
Breast Neoplasms Associate 22626806, 24022895, 33541259, 34291358, 36996499, 37607966
Calcinosis Cutis Stimulate 23715514
Carcinogenesis Associate 18419830, 19258308, 21829201, 21881409, 22012766, 22258704, 24151393