Gene Gene information from NCBI Gene database.
Entrez ID 4440
Gene name Musashi RNA binding protein 1
Gene symbol MSI1
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q24.31
Summary This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlat
miRNA miRNA information provided by mirtarbase database.
408
miRTarBase ID miRNA Experiments Reference
MIRT052295 hsa-let-7b-5p CLASH 23622248
MIRT048066 hsa-miR-197-3p CLASH 23622248
MIRT649997 hsa-miR-501-3p HITS-CLIP 23824327
MIRT649996 hsa-miR-502-3p HITS-CLIP 23824327
MIRT649995 hsa-miR-4719 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IEA
GO:0003723 Function RNA binding TAS 9790759
GO:0003727 Function Single-stranded RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603328 7330 ENSG00000135097
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43347
Protein name RNA-binding protein Musashi homolog 1 (Musashi-1)
Protein function RNA binding protein that regulates the expression of target mRNAs at the translation level. Regulates expression of the NOTCH1 antagonist NUMB. Binds RNA containing the sequence 5'-GUUAGUUAGUUAGUU-3' and other sequences containing the pattern 5'
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 22 91 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 111 180 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Detected in fetal kidney, brain, liver and lung, and in adult brain and pancreas. Detected in hepatoma cell lines. {ECO:0000269|PubMed:12054577, ECO:0000269|PubMed:9790759}.
Sequence
METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRS
RGFGFVTFMDQAGVDKVLAQSRHELDSKTID
PKVAFPRRAQPKMVTRTKKIFVGGLSVNT
TVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVE

CKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYT
YQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGST
PSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNG
YH
Sequence length 362
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  mRNA surveillance pathway