Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4342
Gene name Gene Name - the full gene name approved by the HGNC.	MOS proto-oncogene, serine/threonine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MOS
Synonyms (NCBI Gene) Gene synonyms aliases	MSV, OZEMA20
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q12.1
Summary Summary of gene provided in NCBI Entrez Gene.	MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).[supplied by OMIM, Jul 2009]

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	ISS
GO:0000166	Function	Nucleotide binding	IEA
GO:0000212	Process	Meiotic spindle organization	IEA
GO:0000212	Process	Meiotic spindle organization	ISS
GO:0001556	Process	Oocyte maturation	IMP	34779126, 34997960, 35670744
GO:0004672	Function	Protein kinase activity	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004709	Function	MAP kinase kinase kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	21516116, 22939624, 25036637, 25416956, 28514442, 29892012, 30886144, 31515488, 32296183, 32707033, 33961781, 34779126
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	35670744
GO:0006325	Process	Chromatin organization	IEA
GO:0006325	Process	Chromatin organization	ISS
GO:0007165	Process	Signal transduction	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0040020	Process	Regulation of meiotic nuclear division	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0051296	Process	Establishment of meiotic spindle orientation	IEA
GO:0051296	Process	Establishment of meiotic spindle orientation	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	34779126
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902103	Process	Negative regulation of metaphase/anaphase transition of meiotic cell cycle	IBA
GO:1902103	Process	Negative regulation of metaphase/anaphase transition of meiotic cell cycle	IEA
GO:1902103	Process	Negative regulation of metaphase/anaphase transition of meiotic cell cycle	ISS

MIM	HGNC	e!Ensembl
190060	7199	ENSG00000172680

Protein

UniProt ID

P00540

Protein name

Proto-oncogene serine/threonine-protein kinase mos (EC 2.7.11.1) (Oocyte maturation factor mos) (Proto-oncogene c-Mos)

Protein function

Serine/threonine kinase involved in the regulation of MAPK signaling. Is an activator of the ERK1/2 signaling cascade playing an essential role in the stimulation of oocyte maturation. {ECO:0000269|PubMed:34779126, ECO:0000269|PubMed:34997960, E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	61 → 337	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in oocytes. Lower expression is detected in early embryo. {ECO:0000269|PubMed:34779126}.

Sequence

MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQV
CLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG

Sequence length

346

Interactions

View interactions

	KEGG
	Oocyte meiosis Regulation of actin cytoskeleton Progesterone-mediated oocyte maturation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Oocyte Maturation Defect	oocyte/zygote/embryo maturation arrest 20	N/A	N/A	GenCC
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Atelosteogenesis type 2	Associate	36672822
Bone Marrow Diseases	Associate	23892411
Bone Neoplasms	Associate	23199169
Breast Neoplasms	Associate	2564734, 2996003
Carcinoma Non Small Cell Lung	Associate	11778648
Carcinoma Renal Cell	Associate	6961456
Chromosome Aberrations	Associate	36672822
Colorectal Neoplasms	Associate	15750208
Diabetes Mellitus Type 2	Associate	37781924
Diarrhea	Associate	23892411
Esophageal Neoplasms	Associate	2878411
Growth Disorders	Associate	36672822
Hepatitis C	Associate	15133472
Infertility Female	Associate	36403623
Inflammation	Associate	19814819
Inflammation	Stimulate	37930138
Leukemia	Associate	2996003
Leukemia Lymphocytic Chronic B Cell	Associate	36847709
Leukemia Myeloid	Associate	2993032
Lymphoma	Associate	16401344
Lymphoma B Cell	Associate	6300881
Mucositis	Associate	23892411
Neoplasms	Associate	15133472, 19750229, 2564182, 2878411, 2895024, 35091678
Neoplasms	Inhibit	9635841
NOG Related Symphalangism Spectrum Disorder	Associate	15750208
Oncogene Addiction	Associate	35091678
Sleep Deprivation	Associate	34806827
Stomach Neoplasms	Associate	26087797, 35038821
Thyroid cancer medullary	Associate	8695346

MOS (MOS proto-oncogene, serine/threonine kinase)