Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4257
Gene name Gene Name - the full gene name approved by the HGNC.	Microsomal glutathione S-transferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MGST1
Synonyms (NCBI Gene) Gene synonyms aliases	GST12, MGST, MGST-I, PMAN
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p12.3
Summary Summary of gene provided in NCBI Entrez Gene.	The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family mem

Show/Hide all(84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027876	hsa-miR-96-5p	Sequencing	20371350
MIRT039484	hsa-miR-652-3p	CLASH	23622248
MIRT1147653	hsa-miR-1257	CLIP-seq
MIRT1147654	hsa-miR-1294	CLIP-seq
MIRT1147655	hsa-miR-147	CLIP-seq
MIRT1147656	hsa-miR-182	CLIP-seq
MIRT1147657	hsa-miR-214	CLIP-seq
MIRT1147658	hsa-miR-299-5p	CLIP-seq
MIRT1147659	hsa-miR-3609	CLIP-seq
MIRT1147660	hsa-miR-3619-5p	CLIP-seq
MIRT1147661	hsa-miR-4272	CLIP-seq
MIRT1147662	hsa-miR-4291	CLIP-seq
MIRT1147663	hsa-miR-4506	CLIP-seq
MIRT1147664	hsa-miR-4667-3p	CLIP-seq
MIRT1147665	hsa-miR-4698	CLIP-seq
MIRT1147666	hsa-miR-4700-3p	CLIP-seq
MIRT1147667	hsa-miR-548ah	CLIP-seq
MIRT1147668	hsa-miR-548t	CLIP-seq
MIRT1147669	hsa-miR-629	CLIP-seq
MIRT1147670	hsa-miR-654-3p	CLIP-seq
MIRT1147671	hsa-miR-761	CLIP-seq
MIRT1147672	hsa-miR-767-3p	CLIP-seq
MIRT1147673	hsa-miR-922	CLIP-seq
MIRT1147653	hsa-miR-1257	CLIP-seq
MIRT1147654	hsa-miR-1294	CLIP-seq
MIRT1147655	hsa-miR-147	CLIP-seq
MIRT1147674	hsa-miR-203	CLIP-seq
MIRT1147657	hsa-miR-214	CLIP-seq
MIRT1147659	hsa-miR-3609	CLIP-seq
MIRT1147660	hsa-miR-3619-5p	CLIP-seq
MIRT1147662	hsa-miR-4291	CLIP-seq
MIRT1147675	hsa-miR-4464	CLIP-seq
MIRT1147676	hsa-miR-4748	CLIP-seq
MIRT1147677	hsa-miR-520d-5p	CLIP-seq
MIRT1147678	hsa-miR-524-5p	CLIP-seq
MIRT1147667	hsa-miR-548ah	CLIP-seq
MIRT1147668	hsa-miR-548t	CLIP-seq
MIRT1147670	hsa-miR-654-3p	CLIP-seq
MIRT1147671	hsa-miR-761	CLIP-seq
MIRT1147673	hsa-miR-922	CLIP-seq
MIRT2042046	hsa-miR-548k	CLIP-seq
MIRT2271735	hsa-miR-1243	CLIP-seq
MIRT1147653	hsa-miR-1257	CLIP-seq
MIRT1147654	hsa-miR-1294	CLIP-seq
MIRT2271736	hsa-miR-1324	CLIP-seq
MIRT1147655	hsa-miR-147	CLIP-seq
MIRT1147656	hsa-miR-182	CLIP-seq
MIRT1147674	hsa-miR-203	CLIP-seq
MIRT1147657	hsa-miR-214	CLIP-seq
MIRT2271737	hsa-miR-219-1-3p	CLIP-seq
MIRT2271738	hsa-miR-297	CLIP-seq
MIRT1147658	hsa-miR-299-5p	CLIP-seq
MIRT2271739	hsa-miR-3149	CLIP-seq
MIRT1147659	hsa-miR-3609	CLIP-seq
MIRT1147660	hsa-miR-3619-5p	CLIP-seq
MIRT2271740	hsa-miR-3653	CLIP-seq
MIRT2271741	hsa-miR-3658	CLIP-seq
MIRT2271742	hsa-miR-4263	CLIP-seq
MIRT1147662	hsa-miR-4291	CLIP-seq
MIRT1147675	hsa-miR-4464	CLIP-seq
MIRT2271743	hsa-miR-4495	CLIP-seq
MIRT1147663	hsa-miR-4506	CLIP-seq
MIRT2271744	hsa-miR-4663	CLIP-seq
MIRT1147664	hsa-miR-4667-3p	CLIP-seq
MIRT2271745	hsa-miR-4682	CLIP-seq
MIRT1147665	hsa-miR-4698	CLIP-seq
MIRT1147666	hsa-miR-4700-3p	CLIP-seq
MIRT2271746	hsa-miR-4728-3p	CLIP-seq
MIRT1147676	hsa-miR-4748	CLIP-seq
MIRT2271747	hsa-miR-513a-3p	CLIP-seq
MIRT1147677	hsa-miR-520d-5p	CLIP-seq
MIRT1147678	hsa-miR-524-5p	CLIP-seq
MIRT1147667	hsa-miR-548ah	CLIP-seq
MIRT1147668	hsa-miR-548t	CLIP-seq
MIRT2271748	hsa-miR-548u	CLIP-seq
MIRT2271749	hsa-miR-571	CLIP-seq
MIRT2271750	hsa-miR-576-5p	CLIP-seq
MIRT1147669	hsa-miR-629	CLIP-seq
MIRT1147670	hsa-miR-654-3p	CLIP-seq
MIRT1147671	hsa-miR-761	CLIP-seq
MIRT1147672	hsa-miR-767-3p	CLIP-seq
MIRT1147673	hsa-miR-922	CLIP-seq
MIRT2271743	hsa-miR-4495	CLIP-seq
MIRT1147666	hsa-miR-4700-3p	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	20727966
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IDA	20727966
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	20195357, 32296183
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	20727966
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005778	Component	Peroxisomal membrane	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0034635	Process	Glutathione transport	IDA	20727966
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0071449	Process	Cellular response to lipid hydroperoxide	IDA	20727966
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
138330	7061	ENSG00000008394

Protein

UniProt ID

P10620

Protein name

Microsomal glutathione S-transferase 1 (Microsomal GST-1) (EC 2.5.1.18) (Microsomal GST-I)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01124	MAPEG	16 → 150	MAPEG family	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver. {ECO:0000269|PubMed:3372534}.

Sequence

MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL

Sequence length

155

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Glutathione conjugation Aflatoxin activation and detoxification Neutrophil degranulation

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Postmenopausal breast cancer	N/A	N/A	GWAS
Dementia	Dementia	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Tourette Syndrome	Tourette syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	27486097
Barrett Esophagus	Associate	27486097
Carcinogenesis	Associate	24486338
Carcinoma Ovarian Epithelial	Associate	26091520
Colorectal Neoplasms	Associate	23314968
Conotruncal cardiac defects	Associate	31851787
Crohn Disease	Stimulate	35872023
Diabetes Mellitus Type 2	Associate	35898457
Endometrial Neoplasms	Associate	35218676
Exfoliation Syndrome	Stimulate	23805041
Fibrosis	Associate	34428046
Gastritis Atrophic	Associate	23801863
Head and Neck Neoplasms	Associate	24466029
Heart Defects Congenital	Associate	28264803
Intervertebral Disc Degeneration	Associate	35409356
Intestinal Diseases	Associate	23801863
Leukemia Myeloid Acute	Associate	38186215
Lung Neoplasms	Associate	19887610
Lymphoma Mantle Cell	Associate	29695404
Multiple Myeloma	Associate	27067838
Neoplasms	Associate	34428046, 34715892, 35218676
Neuroblastoma	Associate	24486338
Non alcoholic Fatty Liver Disease	Associate	34428046
Pancreatic Neoplasms	Associate	34143955
Pancreatitis	Associate	38169383
Prostatitis	Associate	11326315
Pulmonary Disease Chronic Obstructive	Associate	32460521
Retinal Dysplasia	Associate	23801863
Stomach Neoplasms	Associate	37161854

MGST1 (microsomal glutathione S-transferase 1)