Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4205
Gene name	Myocyte enhancer factor 2A
Gene symbol	MEF2A
Synonyms (NCBI Gene)	ADCAD1RSRFC4RSRFC9mef2
Chromosome	15
Chromosome location	15q26.3
Summary	The protein encoded by this gene is a DNA-binding transcription factor that activates many muscle-specific, growth factor-induced, and stress-induced genes. The encoded protein can act as a homodimer or as a heterodimer and is involved in several cellular

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918529	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant, genic downstream transcript variant
rs121918530	A>G	Likely-benign, pathogenic	Non coding transcript variant, coding sequence variant, missense variant, genic downstream transcript variant
rs121918531	G>A	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant, genic downstream transcript variant

344

Show/Hide all (344)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000391	hsa-miR-1-3p	Luciferase reporter assay	19188439
MIRT000391	hsa-miR-1-3p	Review	19815577
MIRT000391	hsa-miR-1-3p	qRT-PCR	21169019
MIRT016730	hsa-miR-335-5p	Microarray	18185580
MIRT020561	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT021772	hsa-miR-132-3p	Microarray	17612493
MIRT030700	hsa-miR-21-5p	Microarray	18591254
MIRT049911	hsa-miR-30a-3p	CLASH	23622248
MIRT020561	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT020561	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT727217	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727216	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT735625	hsa-miR-137	Western blottingqRT-PCRImmunocytochemistry (ICC)	32012382
MIRT756030	hsa-miR-615-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	35552173
MIRT1142028	hsa-miR-1245b-3p	CLIP-seq
MIRT1142029	hsa-miR-3915	CLIP-seq
MIRT1142030	hsa-miR-3928	CLIP-seq
MIRT1142031	hsa-miR-4496	CLIP-seq
MIRT1142032	hsa-miR-496	CLIP-seq
MIRT1142033	hsa-miR-651	CLIP-seq
MIRT1142034	hsa-miR-922	CLIP-seq
MIRT1142035	hsa-miR-1912	CLIP-seq
MIRT1142036	hsa-miR-194	CLIP-seq
MIRT1142037	hsa-miR-329	CLIP-seq
MIRT1142038	hsa-miR-362-3p	CLIP-seq
MIRT1142039	hsa-miR-3691-5p	CLIP-seq
MIRT1142040	hsa-miR-3692	CLIP-seq
MIRT1142041	hsa-miR-3929	CLIP-seq
MIRT1142042	hsa-miR-3941	CLIP-seq
MIRT1142043	hsa-miR-4419b	CLIP-seq
MIRT1142044	hsa-miR-4478	CLIP-seq
MIRT1142045	hsa-miR-4491	CLIP-seq
MIRT1142046	hsa-miR-4657	CLIP-seq
MIRT1142047	hsa-miR-4752	CLIP-seq
MIRT1142048	hsa-miR-4756-3p	CLIP-seq
MIRT1142049	hsa-miR-4789-3p	CLIP-seq
MIRT1142050	hsa-miR-576-3p	CLIP-seq
MIRT1142051	hsa-miR-603	CLIP-seq
MIRT1142052	hsa-miR-1299	CLIP-seq
MIRT1142053	hsa-miR-3163	CLIP-seq
MIRT1142054	hsa-miR-3682-5p	CLIP-seq
MIRT1142055	hsa-miR-4782-5p	CLIP-seq
MIRT1142056	hsa-miR-516b	CLIP-seq
MIRT1142057	hsa-miR-1206	CLIP-seq
MIRT1142058	hsa-miR-1228	CLIP-seq
MIRT1142028	hsa-miR-1245b-3p	CLIP-seq
MIRT1142059	hsa-miR-1273d	CLIP-seq
MIRT1142060	hsa-miR-1275	CLIP-seq
MIRT1142061	hsa-miR-129-3p	CLIP-seq
MIRT1142062	hsa-miR-147b	CLIP-seq
MIRT1142036	hsa-miR-194	CLIP-seq
MIRT1142063	hsa-miR-21	CLIP-seq
MIRT1142064	hsa-miR-210	CLIP-seq
MIRT1142065	hsa-miR-298	CLIP-seq
MIRT1142066	hsa-miR-3120-3p	CLIP-seq
MIRT1142067	hsa-miR-3156-5p	CLIP-seq
MIRT1142037	hsa-miR-329	CLIP-seq
MIRT1142068	hsa-miR-342-3p	CLIP-seq
MIRT1142038	hsa-miR-362-3p	CLIP-seq
MIRT1142069	hsa-miR-3659	CLIP-seq
MIRT1142070	hsa-miR-380	CLIP-seq
MIRT1142029	hsa-miR-3915	CLIP-seq
MIRT1142071	hsa-miR-3924	CLIP-seq
MIRT1142030	hsa-miR-3928	CLIP-seq
MIRT1142042	hsa-miR-3941	CLIP-seq
MIRT1142072	hsa-miR-421	CLIP-seq
MIRT1142073	hsa-miR-4260	CLIP-seq
MIRT1142074	hsa-miR-433	CLIP-seq
MIRT1142075	hsa-miR-4433	CLIP-seq
MIRT1142076	hsa-miR-4447	CLIP-seq
MIRT1142077	hsa-miR-4453	CLIP-seq
MIRT1142078	hsa-miR-4472	CLIP-seq
MIRT1142079	hsa-miR-4495	CLIP-seq
MIRT1142080	hsa-miR-4538	CLIP-seq
MIRT1142081	hsa-miR-4651	CLIP-seq
MIRT1142082	hsa-miR-4665-5p	CLIP-seq
MIRT1142083	hsa-miR-4699-3p	CLIP-seq
MIRT1142084	hsa-miR-4709-5p	CLIP-seq
MIRT1142085	hsa-miR-4713-5p	CLIP-seq
MIRT1142086	hsa-miR-4720-3p	CLIP-seq
MIRT1142087	hsa-miR-4755-3p	CLIP-seq
MIRT1142049	hsa-miR-4789-3p	CLIP-seq
MIRT1142088	hsa-miR-499-3p	CLIP-seq
MIRT1142089	hsa-miR-499a-3p	CLIP-seq
MIRT1142090	hsa-miR-501-3p	CLIP-seq
MIRT1142091	hsa-miR-502-3p	CLIP-seq
MIRT1142092	hsa-miR-516a-3p	CLIP-seq
MIRT1142093	hsa-miR-548k	CLIP-seq
MIRT1142094	hsa-miR-548n	CLIP-seq
MIRT1142095	hsa-miR-576-5p	CLIP-seq
MIRT1142096	hsa-miR-578	CLIP-seq
MIRT1142097	hsa-miR-581	CLIP-seq
MIRT1142098	hsa-miR-590-5p	CLIP-seq
MIRT1142051	hsa-miR-603	CLIP-seq
MIRT1142099	hsa-miR-608	CLIP-seq
MIRT1142100	hsa-miR-625	CLIP-seq
MIRT1142101	hsa-miR-665	CLIP-seq
MIRT1142034	hsa-miR-922	CLIP-seq
MIRT1142102	hsa-miR-933	CLIP-seq
MIRT1551211	hsa-miR-190	CLIP-seq
MIRT1551212	hsa-miR-190b	CLIP-seq
MIRT1551213	hsa-miR-3668	CLIP-seq
MIRT1551214	hsa-miR-4418	CLIP-seq
MIRT1551215	hsa-miR-4436b-3p	CLIP-seq
MIRT1551216	hsa-miR-4736	CLIP-seq
MIRT1551217	hsa-miR-4760-5p	CLIP-seq
MIRT1551218	hsa-miR-4761-3p	CLIP-seq
MIRT1551219	hsa-miR-509-3-5p	CLIP-seq
MIRT1551220	hsa-miR-509-5p	CLIP-seq
MIRT1551221	hsa-miR-802	CLIP-seq
MIRT1142062	hsa-miR-147b	CLIP-seq
MIRT1142064	hsa-miR-210	CLIP-seq
MIRT1142071	hsa-miR-3924	CLIP-seq
MIRT1142075	hsa-miR-4433	CLIP-seq
MIRT1142096	hsa-miR-578	CLIP-seq
MIRT1142097	hsa-miR-581	CLIP-seq
MIRT1142101	hsa-miR-665	CLIP-seq
MIRT1142102	hsa-miR-933	CLIP-seq
MIRT1556685	hsa-miR-330-3p	CLIP-seq
MIRT1556686	hsa-miR-4422	CLIP-seq
MIRT1142071	hsa-miR-3924	CLIP-seq
MIRT1142057	hsa-miR-1206	CLIP-seq
MIRT1142058	hsa-miR-1228	CLIP-seq
MIRT1142059	hsa-miR-1273d	CLIP-seq
MIRT1142060	hsa-miR-1275	CLIP-seq
MIRT2040324	hsa-miR-129-5p	CLIP-seq
MIRT2040325	hsa-miR-1322	CLIP-seq
MIRT2040326	hsa-miR-181a	CLIP-seq
MIRT2040327	hsa-miR-181b	CLIP-seq
MIRT2040328	hsa-miR-181c	CLIP-seq
MIRT2040329	hsa-miR-181d	CLIP-seq
MIRT1142036	hsa-miR-194	CLIP-seq
MIRT2040330	hsa-miR-3064-3p	CLIP-seq
MIRT1142066	hsa-miR-3120-3p	CLIP-seq
MIRT2040331	hsa-miR-3148	CLIP-seq
MIRT1142037	hsa-miR-329	CLIP-seq
MIRT1142068	hsa-miR-342-3p	CLIP-seq
MIRT2040332	hsa-miR-3591-3p	CLIP-seq
MIRT1142038	hsa-miR-362-3p	CLIP-seq
MIRT2040333	hsa-miR-3646	CLIP-seq
MIRT2040334	hsa-miR-377	CLIP-seq
MIRT1142071	hsa-miR-3924	CLIP-seq
MIRT1142042	hsa-miR-3941	CLIP-seq
MIRT2040335	hsa-miR-3978	CLIP-seq
MIRT2040336	hsa-miR-410	CLIP-seq
MIRT2040337	hsa-miR-4252	CLIP-seq
MIRT1142073	hsa-miR-4260	CLIP-seq
MIRT2040338	hsa-miR-4262	CLIP-seq
MIRT1142076	hsa-miR-4447	CLIP-seq
MIRT1142078	hsa-miR-4472	CLIP-seq
MIRT2040339	hsa-miR-450b-5p	CLIP-seq
MIRT2040340	hsa-miR-4643	CLIP-seq
MIRT1142081	hsa-miR-4651	CLIP-seq
MIRT2040341	hsa-miR-466	CLIP-seq
MIRT1142082	hsa-miR-4665-5p	CLIP-seq
MIRT2040342	hsa-miR-4668-3p	CLIP-seq
MIRT2040343	hsa-miR-4715-3p	CLIP-seq
MIRT1142087	hsa-miR-4755-3p	CLIP-seq
MIRT2040344	hsa-miR-4776-3p	CLIP-seq
MIRT1142049	hsa-miR-4789-3p	CLIP-seq
MIRT2040345	hsa-miR-4793-5p	CLIP-seq
MIRT1142088	hsa-miR-499-3p	CLIP-seq
MIRT1142089	hsa-miR-499a-3p	CLIP-seq
MIRT2040346	hsa-miR-520g	CLIP-seq
MIRT2040347	hsa-miR-520h	CLIP-seq
MIRT1142094	hsa-miR-548n	CLIP-seq
MIRT2040348	hsa-miR-561	CLIP-seq
MIRT1142096	hsa-miR-578	CLIP-seq
MIRT2040349	hsa-miR-590-3p	CLIP-seq
MIRT1142051	hsa-miR-603	CLIP-seq
MIRT1142099	hsa-miR-608	CLIP-seq
MIRT1142100	hsa-miR-625	CLIP-seq
MIRT1142058	hsa-miR-1228	CLIP-seq
MIRT1142028	hsa-miR-1245b-3p	CLIP-seq
MIRT1142060	hsa-miR-1275	CLIP-seq
MIRT1551211	hsa-miR-190	CLIP-seq
MIRT1551212	hsa-miR-190b	CLIP-seq
MIRT2270129	hsa-miR-197	CLIP-seq
MIRT2270130	hsa-miR-2392	CLIP-seq
MIRT2270131	hsa-miR-23a	CLIP-seq
MIRT2270132	hsa-miR-23b	CLIP-seq
MIRT2270133	hsa-miR-23c	CLIP-seq
MIRT1142065	hsa-miR-298	CLIP-seq
MIRT2270134	hsa-miR-3065-5p	CLIP-seq
MIRT1142066	hsa-miR-3120-3p	CLIP-seq
MIRT2040331	hsa-miR-3148	CLIP-seq
MIRT1142037	hsa-miR-329	CLIP-seq
MIRT1142068	hsa-miR-342-3p	CLIP-seq
MIRT1142038	hsa-miR-362-3p	CLIP-seq
MIRT1551213	hsa-miR-3668	CLIP-seq
MIRT2040334	hsa-miR-377	CLIP-seq
MIRT1142029	hsa-miR-3915	CLIP-seq
MIRT1142071	hsa-miR-3924	CLIP-seq
MIRT1142030	hsa-miR-3928	CLIP-seq
MIRT1142042	hsa-miR-3941	CLIP-seq
MIRT2040335	hsa-miR-3978	CLIP-seq
MIRT1142073	hsa-miR-4260	CLIP-seq
MIRT2270135	hsa-miR-4267	CLIP-seq
MIRT1551214	hsa-miR-4418	CLIP-seq
MIRT1142075	hsa-miR-4433	CLIP-seq
MIRT1551215	hsa-miR-4436b-3p	CLIP-seq
MIRT1142076	hsa-miR-4447	CLIP-seq
MIRT1142078	hsa-miR-4472	CLIP-seq
MIRT2270136	hsa-miR-4632	CLIP-seq
MIRT1142081	hsa-miR-4651	CLIP-seq
MIRT1142082	hsa-miR-4665-5p	CLIP-seq
MIRT2270137	hsa-miR-4666-5p	CLIP-seq
MIRT2040342	hsa-miR-4668-3p	CLIP-seq
MIRT1142083	hsa-miR-4699-3p	CLIP-seq
MIRT1551216	hsa-miR-4736	CLIP-seq
MIRT1142087	hsa-miR-4755-3p	CLIP-seq
MIRT1551217	hsa-miR-4760-5p	CLIP-seq
MIRT1551218	hsa-miR-4761-3p	CLIP-seq
MIRT1142049	hsa-miR-4789-3p	CLIP-seq
MIRT1142088	hsa-miR-499-3p	CLIP-seq
MIRT1142089	hsa-miR-499a-3p	CLIP-seq
MIRT1551219	hsa-miR-509-3-5p	CLIP-seq
MIRT1551220	hsa-miR-509-5p	CLIP-seq
MIRT2270138	hsa-miR-513c	CLIP-seq
MIRT2270139	hsa-miR-514b-5p	CLIP-seq
MIRT1142092	hsa-miR-516a-3p	CLIP-seq
MIRT2270140	hsa-miR-553	CLIP-seq
MIRT1142095	hsa-miR-576-5p	CLIP-seq
MIRT1142096	hsa-miR-578	CLIP-seq
MIRT1142097	hsa-miR-581	CLIP-seq
MIRT1142051	hsa-miR-603	CLIP-seq
MIRT1142099	hsa-miR-608	CLIP-seq
MIRT1142100	hsa-miR-625	CLIP-seq
MIRT1142101	hsa-miR-665	CLIP-seq
MIRT1551221	hsa-miR-802	CLIP-seq
MIRT1142034	hsa-miR-922	CLIP-seq
MIRT1142060	hsa-miR-1275	CLIP-seq
MIRT1556685	hsa-miR-330-3p	CLIP-seq
MIRT1142071	hsa-miR-3924	CLIP-seq
MIRT1142073	hsa-miR-4260	CLIP-seq
MIRT1142076	hsa-miR-4447	CLIP-seq
MIRT1142078	hsa-miR-4472	CLIP-seq
MIRT1142081	hsa-miR-4651	CLIP-seq
MIRT1142082	hsa-miR-4665-5p	CLIP-seq
MIRT1142049	hsa-miR-4789-3p	CLIP-seq
MIRT1142099	hsa-miR-608	CLIP-seq
MIRT1142100	hsa-miR-625	CLIP-seq
MIRT2431090	hsa-miR-101	CLIP-seq
MIRT2431091	hsa-miR-144	CLIP-seq
MIRT2431092	hsa-miR-24	CLIP-seq
MIRT2431093	hsa-miR-3973	CLIP-seq
MIRT2431094	hsa-miR-4284	CLIP-seq
MIRT2431095	hsa-miR-4775	CLIP-seq
MIRT2431096	hsa-miR-495	CLIP-seq
MIRT1142093	hsa-miR-548k	CLIP-seq
MIRT2431090	hsa-miR-101	CLIP-seq
MIRT2569194	hsa-miR-122	CLIP-seq
MIRT1142058	hsa-miR-1228	CLIP-seq
MIRT2569195	hsa-miR-1255a	CLIP-seq
MIRT2569196	hsa-miR-1255b	CLIP-seq
MIRT2569197	hsa-miR-1278	CLIP-seq
MIRT2040324	hsa-miR-129-5p	CLIP-seq
MIRT2569198	hsa-miR-130a	CLIP-seq
MIRT2569199	hsa-miR-130b	CLIP-seq
MIRT2431091	hsa-miR-144	CLIP-seq
MIRT2569200	hsa-miR-148a	CLIP-seq
MIRT2569201	hsa-miR-148b	CLIP-seq
MIRT2569202	hsa-miR-152	CLIP-seq
MIRT2569203	hsa-miR-1825	CLIP-seq
MIRT1142036	hsa-miR-194	CLIP-seq
MIRT2569204	hsa-miR-2116	CLIP-seq
MIRT2569205	hsa-miR-297	CLIP-seq
MIRT2569206	hsa-miR-301a	CLIP-seq
MIRT2569207	hsa-miR-301b	CLIP-seq
MIRT2569208	hsa-miR-3065-3p	CLIP-seq
MIRT2569209	hsa-miR-3074-5p	CLIP-seq
MIRT2569210	hsa-miR-31	CLIP-seq
MIRT2569211	hsa-miR-3140-3p	CLIP-seq
MIRT2040331	hsa-miR-3148	CLIP-seq
MIRT2569212	hsa-miR-3160-5p	CLIP-seq
MIRT2569213	hsa-miR-3187-3p	CLIP-seq
MIRT2569214	hsa-miR-3194-3p	CLIP-seq
MIRT1142037	hsa-miR-329	CLIP-seq
MIRT1556685	hsa-miR-330-3p	CLIP-seq
MIRT1142068	hsa-miR-342-3p	CLIP-seq
MIRT1142038	hsa-miR-362-3p	CLIP-seq
MIRT2040333	hsa-miR-3646	CLIP-seq
MIRT1142069	hsa-miR-3659	CLIP-seq
MIRT2569215	hsa-miR-3666	CLIP-seq
MIRT2569216	hsa-miR-3677-5p	CLIP-seq
MIRT2569217	hsa-miR-3681	CLIP-seq
MIRT1142039	hsa-miR-3691-5p	CLIP-seq
MIRT2569218	hsa-miR-370	CLIP-seq
MIRT2569219	hsa-miR-375	CLIP-seq
MIRT1142070	hsa-miR-380	CLIP-seq
MIRT1142029	hsa-miR-3915	CLIP-seq
MIRT1142071	hsa-miR-3924	CLIP-seq
MIRT1142030	hsa-miR-3928	CLIP-seq
MIRT1142042	hsa-miR-3941	CLIP-seq
MIRT2040335	hsa-miR-3978	CLIP-seq
MIRT2569220	hsa-miR-4261	CLIP-seq
MIRT2569221	hsa-miR-4273	CLIP-seq
MIRT2569222	hsa-miR-4278	CLIP-seq
MIRT2569223	hsa-miR-4295	CLIP-seq
MIRT1556686	hsa-miR-4422	CLIP-seq
MIRT2569224	hsa-miR-4436b-5p	CLIP-seq
MIRT2569225	hsa-miR-4476	CLIP-seq
MIRT2569226	hsa-miR-4480	CLIP-seq
MIRT1142079	hsa-miR-4495	CLIP-seq
MIRT2569227	hsa-miR-4503	CLIP-seq
MIRT2569228	hsa-miR-4529-5p	CLIP-seq
MIRT2569229	hsa-miR-4533	CLIP-seq
MIRT2569230	hsa-miR-454	CLIP-seq
MIRT2569231	hsa-miR-4677-5p	CLIP-seq
MIRT1142085	hsa-miR-4713-5p	CLIP-seq
MIRT2569232	hsa-miR-4716-3p	CLIP-seq
MIRT2569233	hsa-miR-4738-3p	CLIP-seq
MIRT1142087	hsa-miR-4755-3p	CLIP-seq
MIRT2569234	hsa-miR-4778-5p	CLIP-seq
MIRT1142049	hsa-miR-4789-3p	CLIP-seq
MIRT2569235	hsa-miR-548g	CLIP-seq
MIRT2569236	hsa-miR-567	CLIP-seq
MIRT1142096	hsa-miR-578	CLIP-seq
MIRT1142051	hsa-miR-603	CLIP-seq
MIRT2569237	hsa-miR-634	CLIP-seq
MIRT2569238	hsa-miR-659	CLIP-seq
MIRT2569239	hsa-miR-885-5p	CLIP-seq
MIRT2569194	hsa-miR-122	CLIP-seq
MIRT2569197	hsa-miR-1278	CLIP-seq
MIRT1142036	hsa-miR-194	CLIP-seq
MIRT2569205	hsa-miR-297	CLIP-seq
MIRT2569213	hsa-miR-3187-3p	CLIP-seq
MIRT1142037	hsa-miR-329	CLIP-seq
MIRT1142038	hsa-miR-362-3p	CLIP-seq
MIRT2569216	hsa-miR-3677-5p	CLIP-seq
MIRT1142070	hsa-miR-380	CLIP-seq
MIRT1142029	hsa-miR-3915	CLIP-seq
MIRT1142030	hsa-miR-3928	CLIP-seq
MIRT2040335	hsa-miR-3978	CLIP-seq
MIRT2569220	hsa-miR-4261	CLIP-seq
MIRT2569224	hsa-miR-4436b-5p	CLIP-seq
MIRT2569225	hsa-miR-4476	CLIP-seq
MIRT1142079	hsa-miR-4495	CLIP-seq
MIRT2569228	hsa-miR-4529-5p	CLIP-seq
MIRT2569229	hsa-miR-4533	CLIP-seq
MIRT2569233	hsa-miR-4738-3p	CLIP-seq
MIRT2569234	hsa-miR-4778-5p	CLIP-seq
MIRT2569235	hsa-miR-548g	CLIP-seq
MIRT2569236	hsa-miR-567	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
HDAC4	Repression	17179159
HDAC4	Unknown	10748098
HDAC5	Repression	15194749
HDAC5	Unknown	10748098
HDAC7	Repression	11585834
HDAC9	Repression	12242305;15194749
MEF2A	Unknown	18222924

Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16484498
GO:0000165	Process	MAPK cascade	IDA	9858528
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	20590529
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	7760790
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	10748098, 16484498, 20590529
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	7760790, 15466416
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	21468593
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	16043483
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16043483
GO:0005515	Function	Protein binding	IPI	7973707, 15466416, 16043483, 19684601, 20178747, 26871637, 32296183
GO:0005634	Component	Nucleus	IDA	16484498, 20590529
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	16043483
GO:0005829	Component	Cytosol	IDA
GO:0006351	Process	DNA-templated transcription	IDA	16043483
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007507	Process	Heart development	IEP	10458488
GO:0007517	Process	Muscle organ development	NAS	1516833
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IDA	24161931
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IGI	24161931
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0035035	Function	Histone acetyltransferase binding	IPI	20590529
GO:0042826	Function	Histone deacetylase binding	IBA
GO:0042826	Function	Histone deacetylase binding	IPI	10748098, 20590529
GO:0043565	Function	Sequence-specific DNA binding	IDA	10835359
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7760790, 9858528, 10748098, 15466416, 20590529, 21468593
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046332	Function	SMAD binding	IPI	11160896
GO:0046982	Function	Protein heterodimerization activity	IPI	9858528
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048311	Process	Mitochondrion distribution	IEA
GO:0048311	Process	Mitochondrion distribution	ISS
GO:0048513	Process	Animal organ development	IEA
GO:0048813	Process	Dendrite morphogenesis	ISS
GO:0055005	Process	Ventricular cardiac myofibril assembly	IEA
GO:0055005	Process	Ventricular cardiac myofibril assembly	ISS
GO:0061337	Process	Cardiac conduction	IEA
GO:0061337	Process	Cardiac conduction	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	15466416, 16043483
GO:0070375	Process	ERK5 cascade	IMP	15132737
GO:0071277	Process	Cellular response to calcium ion	IDA	16484498
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	20590529

MIM	HGNC	e!Ensembl
600660	6993	ENSG00000068305

Q02078

Protein name

Myocyte-specific enhancer factor 2A (Serum response factor-like protein 1)

Protein function

Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Also involved in the activation of numerous growth factor- and stress-induced genes. Mediates cellular function

PDB

1C7U , 1EGW , 1LEW , 3KOV , 3MU6 , 3P57 , 6BYY , 6BZ1 , 7XUZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00319	SRF-TF	10 → 57	SRF-type transcription factor (DNA-binding and dimerisation domain)	Domain
PF12347	HJURP_C	90 → 154	Holliday junction regulator protein family C-terminal repeat	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform MEF2 and isoform MEFA are expressed only in skeletal and cardiac muscle and in the brain. Isoform RSRFC4 and isoform RSRFC9 are expressed in all tissues examined. {ECO:0000269|PubMed:1516833, ECO:0000269|PubMed:1748287}.

Sequence

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINE
EFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSML
SPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIG
ATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQR
ISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLS
LGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQ
QQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSP
IVLGRPPNTEDRESPSVKRMRMDAWVT

Sequence length

507

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Apelin signaling pathway Parathyroid hormone synthesis, secretion and action Fluid shear stress and atherosclerosis		Myogenesis

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Coronary artery disease, autosomal dominant, 1	Pathogenic	rs1297176531	RCV000009504
Coronary artery disease/myocardial infarction	Pathogenic	rs121918529, rs121918531	RCV000009505 RCV000009507

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
MEF2A-related disorder	Benign; Likely benign	rs325407, rs325400, rs325408, rs3138597, rs778791945, rs199613639, rs530865200, rs34851361, rs3730059	RCV003974578 RCV003979680 RCV003979503 RCV003931597 RCV003939655 RCV003924736 RCV003931942 RCV003979275 RCV003972277 RCV003972724

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	29482603, 31182679
Atrial Fibrillation	Associate	35756425
Behcet Syndrome	Associate	31223615
Breast Neoplasms	Associate	23159930
Carcinogenesis	Associate	40281485
Carcinoma Hepatocellular	Associate	25087096
Carcinoma Non Small Cell Lung	Associate	40589937
Cardiomyopathy Hypertrophic	Associate	32531470
Coronary Artery Disease	Associate	15496429, 15841183, 15958500, 16195615, 25366733, 26415812, 27221044, 27455246, 31182679
Coronary Artery Disease Autosomal Dominant 1	Associate	15958500, 27221044
Diabetes Mellitus	Associate	36978091
Diabetes Mellitus Type 2	Associate	23028138, 32041280
Disease	Associate	31182679
Glioblastoma	Associate	23618224
Glycosuria Renal	Associate	36978091
Heart Failure	Associate	20031589, 22363514
Hypertension Pregnancy Induced	Associate	38006650
Hypoxia	Associate	35552173
Inflammation	Associate	31315839
Labor Pain	Inhibit	29447339
Language Development Disorders	Associate	27016271
Lesch Nyhan Syndrome	Associate	37907926
Leukemia Myeloid Acute	Associate	39329212
Lupus Erythematosus Systemic	Associate	28108556
Melanoma	Associate	37904237
Multiple Myeloma	Associate	32705159
Muscle Neoplasms	Associate	29995456
Myocardial Infarction	Associate	15841171, 15958500, 25838425
Myotonic Dystrophy	Associate	21104860
Myxoma	Associate	12163362
Neoplasms	Associate	31315839, 39329212, 40281485
Neuroinflammatory Diseases	Associate	32746944
Neuromuscular Diseases	Associate	21104860
Norrie disease	Associate	32041280
Pancreatic Neoplasms	Associate	28176830, 40281485
Personality Disorders	Associate	23159930
Prostatic Neoplasms Castration Resistant	Associate	29749452
Psoriasis	Associate	24303025
Psychological Distress	Associate	35552173
Sarcoma	Associate	12163362
Stomach Neoplasms	Associate	25925563, 33613117
Takayasu Arteritis	Associate	31315839

MEF2A (myocyte enhancer factor 2A)