Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4194
Gene name Gene Name - the full gene name approved by the HGNC.
MDM4 regulator of p53
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MDM4
Synonyms (NCBI Gene) Gene synonyms aliases
BMFS6, HDMX, MDMX, MRP1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhib
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004403 hsa-miR-34a-5p Review, Microarray 19461653
MIRT006570 hsa-miR-191-5p Luciferase reporter assay 21084273
MIRT021357 hsa-miR-9-5p Microarray 17612493
MIRT024671 hsa-miR-215-5p Microarray 19074876
MIRT026375 hsa-miR-192-5p Microarray 19074876
Transcription factors
Transcription factor Regulation Reference
TP53 Unknown 20036872;20372076
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 9226370
GO:0003170 Process Heart valve development ISS
GO:0003181 Process Atrioventricular valve morphogenesis ISS
GO:0003203 Process Endocardial cushion morphogenesis ISS
GO:0003281 Process Ventricular septum development ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602704 6974 ENSG00000198625
Protein
UniProt ID O15151
Protein name Protein Mdm4 (Double minute 4 protein) (Mdm2-like p53-binding protein) (Protein Mdmx) (p53-binding protein Mdm4)
Protein function Along with MDM2, contributes to TP53 regulation (PubMed:32300648). Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted
PDB 2CR8 , 2MWY , 2N06 , 2N0U , 2N0W , 2N14 , 2VJE , 2VJF , 2VYR , 3DAB , 3EQY , 3FDO , 3FE7 , 3FEA , 3JZO , 3JZP , 3JZQ , 3LBJ , 3MQR , 3U15 , 4RXZ , 5MNJ , 5UML , 5VK1 , 6Q9Q , 6Q9S , 6Q9U , 6Q9W , 6Q9Y , 6YR5 , 6YR7 , 7C3Q , 7C3Y , 7C44 , 7EL4 , 7KJN , 7MLA , 8HDG , 8IA5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02201 SWIB 25 95 SWIB/MDM2 domain Domain
PF00641 zf-RanBP 300 329 Zn-finger in Ran binding protein and others Domain
PF13920 zf-C3HC4_3 434 484 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested with high levels in thymus.
Sequence
MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDP
SPLYDMLRKNLVTLATATTDAAQTL
ALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQ
DETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWF
LNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTS
EDEWQCTECKKFNSPSKRYCFRCWALRKD
WYSDCSKLTHSLSTSDITAIPEKENEGNDVP
DCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ
RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE
IQLV
IKVFIA
Sequence length 490
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  p53 signaling pathway
MicroRNAs in cancer
  Oxidative Stress Induced Senescence
Oncogene Induced Senescence
Ub-specific processing proteases
Regulation of TP53 Activity through Phosphorylation
Regulation of TP53 Degradation
Regulation of TP53 Activity through Methylation
Stabilization of p53
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Bone Marrow Failure Syndrome bone marrow failure syndrome 6 N/A N/A GenCC
Breast cancer Breast cancer, Breast Cancer in BRCA1 mutation carriers, Breast cancer (estrogen-receptor negative) N/A N/A GWAS
Breast Cancer Breast cancer (estrogen-receptor negative, progesterone-receptor negative, and human epidermal growth factor-receptor negative) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Associate 34618298
Adenocarcinoma of Lung Associate 27462918
Aneuploidy Stimulate 25405759
Astrocytoma Associate 20068183
Atrioventricular Septal Defect Associate 25996639
Brain Neoplasms Associate 23508638
Breast Neoplasms Associate 21750655, 23544013, 24667108, 26001071, 26095524, 26471763, 26909605, 29697201, 31181622, 32802855, 35461219, 38400758, 39614330
Burkitt Lymphoma Associate 19759907, 22845047
Carcinogenesis Associate 19497887, 21540763, 24667108, 28099948, 30672125, 38281029
Carcinoma Associate 34312479