Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4135
Gene name	Microtubule associated protein 6
Gene symbol	MAP6
Synonyms (NCBI Gene)	MAP6-NMTAP6N-STOPSTOP
Chromosome	11
Chromosome location	11q13.5
Summary	This gene encodes a microtubule-associated protein. The encoded protein is a calmodulin-binding and calmodulin-regulated protein that is involved in microtubule stabilization. Two transcript variants encoding distinct isoforms have been identified for thi

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments
MIRT1129687	hsa-miR-1279	CLIP-seq
MIRT1129688	hsa-miR-133a	CLIP-seq
MIRT1129689	hsa-miR-133b	CLIP-seq
MIRT1129690	hsa-miR-182	CLIP-seq
MIRT1129691	hsa-miR-2861	CLIP-seq
MIRT1129692	hsa-miR-3669	CLIP-seq
MIRT1129693	hsa-miR-4263	CLIP-seq
MIRT1129694	hsa-miR-4269	CLIP-seq
MIRT1129695	hsa-miR-4281	CLIP-seq
MIRT1129696	hsa-miR-4292	CLIP-seq
MIRT1129697	hsa-miR-4308	CLIP-seq
MIRT1129698	hsa-miR-4462	CLIP-seq
MIRT1129699	hsa-miR-4470	CLIP-seq
MIRT1129700	hsa-miR-4476	CLIP-seq
MIRT1129701	hsa-miR-4789-5p	CLIP-seq
MIRT1129702	hsa-miR-4795-3p	CLIP-seq
MIRT1129703	hsa-miR-486-3p	CLIP-seq
MIRT1129704	hsa-miR-493	CLIP-seq
MIRT1129705	hsa-miR-576-5p	CLIP-seq
MIRT1129706	hsa-miR-598	CLIP-seq
MIRT1129707	hsa-miR-656	CLIP-seq
MIRT1556646	hsa-miR-1253	CLIP-seq
MIRT1556647	hsa-miR-1275	CLIP-seq
MIRT1556648	hsa-miR-185	CLIP-seq
MIRT1556649	hsa-miR-4259	CLIP-seq
MIRT1556650	hsa-miR-4306	CLIP-seq
MIRT1556651	hsa-miR-4419a	CLIP-seq
MIRT1556652	hsa-miR-4510	CLIP-seq
MIRT1556653	hsa-miR-4644	CLIP-seq
MIRT1556654	hsa-miR-4665-5p	CLIP-seq
MIRT1556655	hsa-miR-4723-5p	CLIP-seq
MIRT1556656	hsa-miR-4728-5p	CLIP-seq
MIRT2036943	hsa-let-7a	CLIP-seq
MIRT2036944	hsa-let-7b	CLIP-seq
MIRT2036945	hsa-let-7c	CLIP-seq
MIRT2036946	hsa-let-7d	CLIP-seq
MIRT2036947	hsa-let-7e	CLIP-seq
MIRT2036948	hsa-let-7f	CLIP-seq
MIRT2036949	hsa-let-7g	CLIP-seq
MIRT2036950	hsa-let-7i	CLIP-seq
MIRT1556646	hsa-miR-1253	CLIP-seq
MIRT1556647	hsa-miR-1275	CLIP-seq
MIRT2036951	hsa-miR-1304	CLIP-seq
MIRT2036952	hsa-miR-1324	CLIP-seq
MIRT1556648	hsa-miR-185	CLIP-seq
MIRT2036953	hsa-miR-202	CLIP-seq
MIRT2036954	hsa-miR-2110	CLIP-seq
MIRT2036955	hsa-miR-3180	CLIP-seq
MIRT2036956	hsa-miR-3180-3p	CLIP-seq
MIRT2036957	hsa-miR-3196	CLIP-seq
MIRT2036958	hsa-miR-3545-3p	CLIP-seq
MIRT1556649	hsa-miR-4259	CLIP-seq
MIRT1556650	hsa-miR-4306	CLIP-seq
MIRT1556651	hsa-miR-4419a	CLIP-seq
MIRT2036959	hsa-miR-4447	CLIP-seq
MIRT2036960	hsa-miR-4458	CLIP-seq
MIRT2036961	hsa-miR-4472	CLIP-seq
MIRT2036962	hsa-miR-4475	CLIP-seq
MIRT2036963	hsa-miR-4481	CLIP-seq
MIRT2036964	hsa-miR-4488	CLIP-seq
MIRT2036965	hsa-miR-4500	CLIP-seq
MIRT2036966	hsa-miR-4509	CLIP-seq
MIRT1556652	hsa-miR-4510	CLIP-seq
MIRT1556653	hsa-miR-4644	CLIP-seq
MIRT2036967	hsa-miR-4659a-3p	CLIP-seq
MIRT2036968	hsa-miR-4659b-3p	CLIP-seq
MIRT1556654	hsa-miR-4665-5p	CLIP-seq
MIRT2036969	hsa-miR-4697-5p	CLIP-seq
MIRT1556655	hsa-miR-4723-5p	CLIP-seq
MIRT1556656	hsa-miR-4728-5p	CLIP-seq
MIRT2036970	hsa-miR-4745-5p	CLIP-seq
MIRT2036971	hsa-miR-642b	CLIP-seq
MIRT2036972	hsa-miR-98	CLIP-seq
MIRT1129700	hsa-miR-4476	CLIP-seq
MIRT2267035	hsa-miR-873	CLIP-seq
MIRT1556651	hsa-miR-4419a	CLIP-seq
MIRT1556652	hsa-miR-4510	CLIP-seq
MIRT1556656	hsa-miR-4728-5p	CLIP-seq
MIRT2390588	hsa-miR-671-5p	CLIP-seq
MIRT2566730	hsa-miR-3611	CLIP-seq
MIRT2566731	hsa-miR-4264	CLIP-seq
MIRT2566732	hsa-miR-4320	CLIP-seq
MIRT2566733	hsa-miR-4677-3p	CLIP-seq
MIRT2566734	hsa-miR-4679	CLIP-seq
MIRT2566735	hsa-miR-622	CLIP-seq
MIRT2566730	hsa-miR-3611	CLIP-seq
MIRT2566731	hsa-miR-4264	CLIP-seq
MIRT2566732	hsa-miR-4320	CLIP-seq
MIRT2566733	hsa-miR-4677-3p	CLIP-seq
MIRT2566734	hsa-miR-4679	CLIP-seq
MIRT2566735	hsa-miR-622	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0005515	Function	Protein binding	IPI	24357581, 26198635
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005798	Component	Golgi-associated vesicle	IBA
GO:0005801	Component	Cis-Golgi network	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IDA	17210638
GO:0005874	Component	Microtubule	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030705	Process	Cytoskeleton-dependent intracellular transport	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032418	Process	Lysosome localization	IMP	24357581
GO:0042995	Component	Cell projection	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17210638
GO:0048813	Process	Dendrite morphogenesis	IBA
GO:0048813	Process	Dendrite morphogenesis	IMP	24357581
GO:0050772	Process	Positive regulation of axonogenesis	IBA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IBA

MIM	HGNC	e!Ensembl
601783	6868	ENSG00000171533

Q96JE9

Protein name

Microtubule-associated protein 6 (MAP-6) (Stable tubule-only polypeptide) (STOP)

Protein function

Involved in microtubule stabilization in many cell types, including neuronal cells (By similarity). Specifically has microtubule cold stabilizing activity (By similarity). Involved in dendrite morphogenesis and maintenance by regulating lysosoma

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain (at protein level). Expressed in spinal cord. Isoform 2 expression is up-regulated in the prefrontal cortex (Brodmann's area 46) of patients with schizophrenia (postmortem brain study). {ECO:0000269|PubMed:14692697,

Sequence

MAWPCITRACCIARFWNQLDKADIAVPLVFTKYSEATEHPGAPPQPPPPQQQAQPALAPP
SARAVAIETQPAQGELDAVARATGPAPGPTGEREPAAGPGRSGPGPGLGSGSTSGPADSV
MRQDYRAWKVQRPEPSCRPRSEYQPSDAPFERETQYQKDFRAWPLPRRGDHPWIPKPVQI
SAASQASAPILGAPKRRPQSQERWPVQAAAEAREQEAAPGGAGGLAAGKASGADERDTRR
KAGPAWIVRRAEGLGHEQTPLPAAQAQVQATGPEAGRGRAAADALNRQIREEVASAVSSS
YRNEFRAWTDIKPVKPIKAKPQYKPPDDKMVHETSYSAQFKGEASKPTTADNKVIDRRRI
RSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTK
PDDKEQSKEMNNKLAEAKESLAQPVSDSSKTQGPVATEPDKDQGSVVPGLLKGQGPMVQE
PLKKQGSVVPGPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQ
SPMVPAKVKDQGSVVPESLKDQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVS
APVKDQGPIVPAPVKGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKN
QGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVAPVKNQGPVVPESVKNQDPIL
PVLVKDQGPTVLQPPKNQGRIVPEPLKNQVPIVPVPLKDQDPLVPVPAKDQGPAVPEPLK
TQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP

Sequence length

813

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs12225010	RCV005915301
Cervical cancer	Benign	rs12225010	RCV005915302
Cholangiocarcinoma	Benign	rs12225010	RCV005915305
Gastric cancer	Benign	rs12225010	RCV005915303
Lung cancer	Benign	rs12225010	RCV005915306
Thymoma	Benign	rs12225010	RCV005915304

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Lymphoma Mantle Cell	Associate	19016712
Uniparental Disomy	Associate	33494996

MAP6 (microtubule associated protein 6)