Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4128
Gene name Gene Name - the full gene name approved by the HGNC.	Monoamine oxidase A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAOA
Synonyms (NCBI Gene) Gene synonyms aliases	BRNRS, MAO-A
Disease Acronyms (UniProt) Disease acronyms from UniProt database	BRNRS
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp11.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has

Show/Hide all(7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs72554632	C>T	Pathogenic	Coding sequence variant, stop gained
rs138703731	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity, benign	Coding sequence variant, synonymous variant
rs587777457	G>T	Pathogenic	Missense variant, coding sequence variant
rs796065311	->T	Pathogenic	Frameshift variant, coding sequence variant
rs796065312	C>T	Pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs1135401773	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1555951288	A>G	Pathogenic	Splice acceptor variant

Show/Hide all(156)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005902	hsa-miR-22-3p	Luciferase reporter assay, Microarray	21168126
MIRT1127569	hsa-miR-1202	CLIP-seq
MIRT1127570	hsa-miR-1255a	CLIP-seq
MIRT1127571	hsa-miR-1255b	CLIP-seq
MIRT1127572	hsa-miR-197	CLIP-seq
MIRT1127573	hsa-miR-21	CLIP-seq
MIRT1127574	hsa-miR-28-3p	CLIP-seq
MIRT1127575	hsa-miR-3123	CLIP-seq
MIRT1127576	hsa-miR-3125	CLIP-seq
MIRT1127577	hsa-miR-3126-5p	CLIP-seq
MIRT1127578	hsa-miR-3148	CLIP-seq
MIRT1127579	hsa-miR-3169	CLIP-seq
MIRT1127580	hsa-miR-330-3p	CLIP-seq
MIRT1127581	hsa-miR-3545-5p	CLIP-seq
MIRT1127582	hsa-miR-3611	CLIP-seq
MIRT1127583	hsa-miR-3614-3p	CLIP-seq
MIRT1127584	hsa-miR-3616-5p	CLIP-seq
MIRT1127585	hsa-miR-3647-5p	CLIP-seq
MIRT1127586	hsa-miR-3650	CLIP-seq
MIRT1127587	hsa-miR-3653	CLIP-seq
MIRT1127588	hsa-miR-3658	CLIP-seq
MIRT1127589	hsa-miR-3663-3p	CLIP-seq
MIRT1127590	hsa-miR-3672	CLIP-seq
MIRT1127591	hsa-miR-3681	CLIP-seq
MIRT1127592	hsa-miR-3691-5p	CLIP-seq
MIRT1127593	hsa-miR-371-5p	CLIP-seq
MIRT1127594	hsa-miR-371b-5p	CLIP-seq
MIRT1127595	hsa-miR-3916	CLIP-seq
MIRT1127596	hsa-miR-3919	CLIP-seq
MIRT1127597	hsa-miR-3920	CLIP-seq
MIRT1127598	hsa-miR-3925-5p	CLIP-seq
MIRT1127599	hsa-miR-3972	CLIP-seq
MIRT1127600	hsa-miR-4310	CLIP-seq
MIRT1127601	hsa-miR-4317	CLIP-seq
MIRT1127602	hsa-miR-4423-5p	CLIP-seq
MIRT1127603	hsa-miR-4424	CLIP-seq
MIRT1127604	hsa-miR-4433	CLIP-seq
MIRT1127605	hsa-miR-4436a	CLIP-seq
MIRT1127606	hsa-miR-4459	CLIP-seq
MIRT1127607	hsa-miR-4468	CLIP-seq
MIRT1127608	hsa-miR-4470	CLIP-seq
MIRT1127609	hsa-miR-4475	CLIP-seq
MIRT1127610	hsa-miR-4502	CLIP-seq
MIRT1127611	hsa-miR-4511	CLIP-seq
MIRT1127612	hsa-miR-452	CLIP-seq
MIRT1127613	hsa-miR-4645-3p	CLIP-seq
MIRT1127614	hsa-miR-4676-3p	CLIP-seq
MIRT1127615	hsa-miR-4682	CLIP-seq
MIRT1127616	hsa-miR-4693-5p	CLIP-seq
MIRT1127617	hsa-miR-4740-5p	CLIP-seq
MIRT1127618	hsa-miR-4756-3p	CLIP-seq
MIRT1127619	hsa-miR-4762-3p	CLIP-seq
MIRT1127620	hsa-miR-4766-3p	CLIP-seq
MIRT1127621	hsa-miR-4768-3p	CLIP-seq
MIRT1127622	hsa-miR-4773	CLIP-seq
MIRT1127623	hsa-miR-4774-3p	CLIP-seq
MIRT1127624	hsa-miR-4795-5p	CLIP-seq
MIRT1127625	hsa-miR-486-3p	CLIP-seq
MIRT1127626	hsa-miR-499-3p	CLIP-seq
MIRT1127627	hsa-miR-499a-3p	CLIP-seq
MIRT1127628	hsa-miR-512-5p	CLIP-seq
MIRT1127629	hsa-miR-513c	CLIP-seq
MIRT1127630	hsa-miR-514b-5p	CLIP-seq
MIRT1127631	hsa-miR-518d-5p	CLIP-seq
MIRT1127632	hsa-miR-519b-5p	CLIP-seq
MIRT1127633	hsa-miR-519c-5p	CLIP-seq
MIRT1127634	hsa-miR-520c-5p	CLIP-seq
MIRT1127635	hsa-miR-526a	CLIP-seq
MIRT1127636	hsa-miR-532-5p	CLIP-seq
MIRT1127637	hsa-miR-548b-3p	CLIP-seq
MIRT1127638	hsa-miR-548p	CLIP-seq
MIRT1127639	hsa-miR-573	CLIP-seq
MIRT1127640	hsa-miR-576-3p	CLIP-seq
MIRT1127641	hsa-miR-584	CLIP-seq
MIRT1127642	hsa-miR-590-5p	CLIP-seq
MIRT1127643	hsa-miR-592	CLIP-seq
MIRT1127644	hsa-miR-597	CLIP-seq
MIRT1127645	hsa-miR-621	CLIP-seq
MIRT1920607	hsa-miR-450b-5p	CLIP-seq
MIRT1127619	hsa-miR-4762-3p	CLIP-seq
MIRT1920608	hsa-miR-4766-5p	CLIP-seq
MIRT1920609	hsa-miR-507	CLIP-seq
MIRT1920610	hsa-miR-557	CLIP-seq
MIRT1920607	hsa-miR-450b-5p	CLIP-seq
MIRT1127619	hsa-miR-4762-3p	CLIP-seq
MIRT1920608	hsa-miR-4766-5p	CLIP-seq
MIRT1920609	hsa-miR-507	CLIP-seq
MIRT1920610	hsa-miR-557	CLIP-seq
MIRT1920607	hsa-miR-450b-5p	CLIP-seq
MIRT1127619	hsa-miR-4762-3p	CLIP-seq
MIRT1920608	hsa-miR-4766-5p	CLIP-seq
MIRT1920609	hsa-miR-507	CLIP-seq
MIRT1920610	hsa-miR-557	CLIP-seq
MIRT2036154	hsa-miR-1200	CLIP-seq
MIRT2036155	hsa-miR-1228	CLIP-seq
MIRT2036156	hsa-miR-1305	CLIP-seq
MIRT2036157	hsa-miR-1324	CLIP-seq
MIRT2036158	hsa-miR-1827	CLIP-seq
MIRT2036159	hsa-miR-3136-3p	CLIP-seq
MIRT2036160	hsa-miR-3145-5p	CLIP-seq
MIRT2036161	hsa-miR-3622b-5p	CLIP-seq
MIRT1127587	hsa-miR-3653	CLIP-seq
MIRT2036162	hsa-miR-380	CLIP-seq
MIRT2036163	hsa-miR-382	CLIP-seq
MIRT2036164	hsa-miR-421	CLIP-seq
MIRT2036165	hsa-miR-425	CLIP-seq
MIRT2036166	hsa-miR-4324	CLIP-seq
MIRT2036167	hsa-miR-4423-3p	CLIP-seq
MIRT2036168	hsa-miR-4426	CLIP-seq
MIRT1127604	hsa-miR-4433	CLIP-seq
MIRT1127606	hsa-miR-4459	CLIP-seq
MIRT1127608	hsa-miR-4470	CLIP-seq
MIRT2036169	hsa-miR-4495	CLIP-seq
MIRT2036170	hsa-miR-4639-5p	CLIP-seq
MIRT2036171	hsa-miR-4647	CLIP-seq
MIRT2036172	hsa-miR-4649-3p	CLIP-seq
MIRT2036173	hsa-miR-4662b	CLIP-seq
MIRT2036174	hsa-miR-4691-5p	CLIP-seq
MIRT2036175	hsa-miR-4712-5p	CLIP-seq
MIRT2036176	hsa-miR-4733-3p	CLIP-seq
MIRT1127621	hsa-miR-4768-3p	CLIP-seq
MIRT2036177	hsa-miR-4802-3p	CLIP-seq
MIRT2036178	hsa-miR-491-3p	CLIP-seq
MIRT2036179	hsa-miR-508-5p	CLIP-seq
MIRT2036180	hsa-miR-513b	CLIP-seq
MIRT2036181	hsa-miR-543	CLIP-seq
MIRT2036182	hsa-miR-544b	CLIP-seq
MIRT2036183	hsa-miR-605	CLIP-seq
MIRT2036184	hsa-miR-770-5p	CLIP-seq
MIRT2036185	hsa-miR-922	CLIP-seq
MIRT2036154	hsa-miR-1200	CLIP-seq
MIRT2266483	hsa-miR-3074-5p	CLIP-seq
MIRT2266484	hsa-miR-4796-3p	CLIP-seq
MIRT2266485	hsa-miR-520g	CLIP-seq
MIRT2266486	hsa-miR-520h	CLIP-seq
MIRT2266487	hsa-miR-640	CLIP-seq
MIRT1127593	hsa-miR-371-5p	CLIP-seq
MIRT1127594	hsa-miR-371b-5p	CLIP-seq
MIRT1127629	hsa-miR-513c	CLIP-seq
MIRT1127630	hsa-miR-514b-5p	CLIP-seq
MIRT2565872	hsa-miR-1253	CLIP-seq
MIRT2565873	hsa-miR-22	CLIP-seq
MIRT2565874	hsa-miR-4271	CLIP-seq
MIRT2565875	hsa-miR-4297	CLIP-seq
MIRT2565876	hsa-miR-4685-5p	CLIP-seq
MIRT2565877	hsa-miR-4716-3p	CLIP-seq
MIRT2565878	hsa-miR-4725-3p	CLIP-seq
MIRT2565879	hsa-miR-625	CLIP-seq
MIRT2565872	hsa-miR-1253	CLIP-seq
MIRT2565873	hsa-miR-22	CLIP-seq
MIRT2565874	hsa-miR-4271	CLIP-seq
MIRT2565875	hsa-miR-4297	CLIP-seq
MIRT2565876	hsa-miR-4685-5p	CLIP-seq
MIRT2565877	hsa-miR-4716-3p	CLIP-seq
MIRT2565878	hsa-miR-4725-3p	CLIP-seq
MIRT2565879	hsa-miR-625	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NHLH2	Activation	22169038
NR3C1	Unknown	16728402

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 30021884
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	IDA
GO:0005741	Component	Mitochondrial outer membrane	TAS	24252804
GO:0005829	Component	Cytosol	IDA
GO:0006576	Process	Cellular biogenic amine metabolic process	TAS	8211186
GO:0008131	Function	Primary amine oxidase activity	IEA
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0042133	Process	Neurotransmitter metabolic process	TAS
GO:0042135	Process	Neurotransmitter catabolic process	IEA
GO:0042420	Process	Dopamine catabolic process	TAS	24252804

MIM	HGNC	e!Ensembl
309850	6833	ENSG00000189221

Protein

UniProt ID

P21397

Protein name

Amine oxidase [flavin-containing] A (EC 1.4.3.21) (EC 1.4.3.4) (Monoamine oxidase type A) (MAO-A)

Protein function

Catalyzes the oxidative deamination of primary and some secondary amine such as neurotransmitters, with concomitant reduction of oxygen to hydrogen peroxide and has important functions in the metabolism of neuroactive and vasoactive amines in th

PDB

2BXR , 2BXS , 2Z5X , 2Z5Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01593	Amino_oxidase	23 → 460	Flavin containing amine oxidoreductase	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, liver, duodenum, blood vessels and kidney.

Sequence

MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS

Sequence length

527

Interactions

View interactions

	KEGG		Reactome
	Glycine, serine and threonine metabolism Arginine and proline metabolism Histidine metabolism Tyrosine metabolism Phenylalanine metabolism Tryptophan metabolism Drug metabolism - cytochrome P450 Metabolic pathways Serotonergic synapse Dopaminergic synapse Parkinson disease Cocaine addiction Amphetamine addiction Alcoholism		Biogenic amines are oxidatively deaminated to aldehydes by MAOA and MAOB Norepinephrine Neurotransmitter Release Cycle Enzymatic degradation of dopamine by COMT Enzymatic degradation of Dopamine by monoamine oxidase Metabolism of serotonin Defective MAOA causes Brunner syndrome (BRUNS) Interleukin-4 and Interleukin-13 signaling

Show/Hide Causal Diseases (9)

Disease term	Disease name	dbSNP ID	References
Causal
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	20573161, 12919132, 18361446
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Brugada syndrome	Brunner Syndrome	rs104894718, rs397514252, rs397514446, rs137854613, rs137854601, rs397514449, rs137854604, rs28937318, rs137854611, rs137854612, rs137854615, rs137854618, rs137854620, rs72554632, rs121912776 View all (97 more)	8211186, 25807999, 27830117, 24169519
Liver failure	Chronic Liver Failure	rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116 View all (10 more)	15025246
Mental retardation	Mental Retardation, X-Linked, Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)	8503438
Myopathy	Myopathy	rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166 View all (81 more)	15946989
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	17449559
Pheochromocytoma	Pheochromocytoma	rs121908826, rs121908830, rs121908821, rs5030821, rs5030820, rs104893826, rs5030808, rs587776644, rs80338844, rs104894306, rs104894309, rs75076352, rs75996173, rs77709286, rs74799832 View all (30 more)	22569243
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	25073638, 24510409

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Behavior disorders	Behavior Disorders	22340208	ClinVar
Endometriosis	Endometriosis	21063030	ClinVar
Huntington disease	Huntington Disease, Huntington Disease, Late Onset, Juvenile Huntington Disease	21075085	ClinVar
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder, clinical depression	24314147, 23512949, 25623016, 24652311, 25152370, 23157339, 23221997, 22030358, 21654740, 24809685, 22045496, 21373759	ClinVar

Show/Hide Text Mining Associations (135)

Disease Name	Relationship Type	References
Associations from Text Mining
Abuse dwarfism syndrome	Associate	22030358
Acrophobia	Associate	30169842
Adenocarcinoma of Lung	Associate	34301211
Agoraphobia	Associate	15670397
AIDS Associated Nephropathy	Associate	24244526
Alcohol Related Disorders	Associate	21628708, 22610759
Alcoholism	Associate	17476365, 18454435, 20850185, 22030358, 22552845, 28345608, 29600412
Alzheimer Disease	Associate	18454435, 26417591
Amyotrophic Lateral Sclerosis	Associate	34194442
Amyotrophic lateral sclerosis 1	Associate	34194442
Anhedonia	Associate	21295226, 29600412
Antisocial Personality Disorder	Associate	17429405, 18454435, 19120058, 19804559, 20175604, 20201935, 20364435, 20850185, 21152968, 21295226, 21554924, 21628708, 22297589, 22552845, 22610759 View all (8 more)
Anxiety	Associate	18566880, 24118915, 30656852, 31448578, 35396540
Anxiety Disorders	Associate	24118915, 25059547, 25547397, 32133483
Aphasia	Associate	22365943
Asthma	Associate	20826063
Atherosclerosis	Associate	23116433, 23723362, 30021838
Attention Deficit and Disruptive Behavior Disorders	Associate	18430257, 19309535, 30126429
Attention Deficit Disorder with Hyperactivity	Associate	16894395, 17328795, 18430257, 18566880, 19309535, 19661285, 21778150, 23746540, 24169519, 24977324, 27341797, 28982350, 30344263, 30379906, 37285328
Auditory Perceptual Disorders	Associate	18566880
Autism Spectrum Disorder	Associate	18566880, 19100789, 21538940, 24169519, 33767242
Autistic Disorder	Associate	18361446, 19661285, 21538940, 24169519
Autoimmune Diseases	Associate	20826063
Bipolar Disorder	Associate	19357553, 27063557
Bone Diseases	Associate	28993189
Borderline Personality Disorder	Associate	22139575
Brain Diseases	Associate	21422455, 31441562
Brain Injuries Traumatic	Associate	21422455
Breast Neoplasms	Associate	29261141, 29775160, 31754354, 35686034, 37841082
Brunner Syndrome	Associate	24169519, 34923109, 36536002
Carcinogenesis	Associate	36233054, 37841082
Carcinoma Hepatocellular	Inhibit	24607627
Carcinoma Non Small Cell Lung	Associate	32792865, 32875729
Carcinoma Renal Cell	Associate	23197227
Cardiomegaly	Associate	18361446
Carotid Artery Diseases	Associate	23116433
Cocaine Related Disorders	Associate	21383264
Colonic Neoplasms	Associate	34564978
Conduct Disorder	Associate	18752729, 20364435
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Associate	20175604, 22781862
COVID 19	Associate	36611805
Crohn Disease	Stimulate	35872023
Cutaneous Fistula	Associate	20364435
Dementia	Associate	17585061
Depressive Disorder	Associate	17585061, 19337825, 19357553, 19572987, 19661285, 20175604, 20826063, 21605465, 25059547, 25655492, 29600412, 30656852, 40416692
Depressive Disorder Major	Associate	19357553, 19657584, 21605465, 22030358, 32524199
Developmental Disabilities	Associate	20485326
Diabetes Mellitus	Associate	37958805
Disease	Associate	35749392
Disruptive Impulse Control and Conduct Disorders	Associate	18566880, 19357553, 22365943, 31441562
Dyskinesia Drug Induced	Associate	24008922
Dysthymic Disorder	Associate	22030358
Endplate Acetylcholinesterase Deficiency	Associate	34104646
Epstein Barr Virus Infections	Inhibit	32273550
Esophageal Squamous Cell Carcinoma	Inhibit	22499122
Glioblastoma	Associate	16728402, 31556016
Glioma	Associate	28722111, 31556016
Hand Injuries	Associate	20485326
Head Injuries Penetrating	Associate	21422455
Heart Failure	Associate	28044091
Hepatic Encephalopathy	Associate	9048767
Hepatitis B	Stimulate	29261141
Hereditary leiomyomatosis and renal cell cancer	Associate	28722111
Heroin Dependence	Associate	28345608
Hyperkinesis	Associate	19804559
Immunologic Deficiency Syndromes	Inhibit	15654081
Immunologic Deficiency Syndromes	Associate	22365943, 23746540
Inflammation	Associate	30021838, 34445126
Insulin Resistance	Associate	20595415
Intellectual Disability	Associate	22365943, 23871722, 36536002, 8613523
Kidney Neoplasms	Associate	23197227
Leprosy Tuberculoid	Associate	19661285
Lung Neoplasms	Associate	28617549, 30021838
Lymphangioleiomyomatosis	Associate	34378323
Lymphatic Metastasis	Stimulate	37403079
Lymphedema	Associate	20850185
Lymphoma Follicular	Associate	18804811
Mental Disorders	Associate	12366871, 18212819, 18391214, 18454435, 19661285, 19804559, 21628708, 22297589, 22365943, 22885141, 23723362, 24169519, 24607627, 25060544, 25349169 View all (7 more)
Mental Retardation X Linked	Associate	8503438
Migraine Disorders	Associate	20213484
Migraine with Aura	Associate	19772578
Migraine without Aura	Associate	19772578
Mitochondrial Diseases	Associate	21678067, 36915111, 37410216
Mouth Diseases	Associate	21422455
Muscle Hypotonia	Associate	20485326, 22365943
Muscular Dystrophy Congenital Megaconial Type	Associate	28851912
Nasopharyngeal Carcinoma	Inhibit	32273550
Neoplasm Metastasis	Inhibit	24607627
Neoplasm Metastasis	Associate	30974737
Neoplasm Metastasis	Stimulate	32792865
Neoplasms	Associate	16829574, 18804811, 23197227, 26689994, 30021838, 32273550, 33855088, 36233054, 36627132, 37403079
Neoplasms	Inhibit	17229543, 24607627, 25389533
Neoplasms	Stimulate	32792865
Nerve Degeneration	Associate	16336631
Neuroblastoma	Associate	16728402, 17883400, 30336354
Neurodegenerative Diseases	Associate	16336631
Neuroendocrine Tumors	Associate	28402333
Neurologic Manifestations	Associate	19572987, 23197227, 26690459, 30021838
Norrie disease	Associate	2773935, 7908152, 8613523
Obesity	Associate	19337825, 19818126, 20826063, 23761378
Obsessive Compulsive Disorder	Associate	32133483
Osteitis Deformans	Associate	28993189
Overweight	Associate	19337825
Panic Disorder	Associate	15670397, 22436428, 27045843, 32524199
Parkinson Disease	Associate	16336631, 30336354, 34528139
Parkinson Disease Secondary	Associate	2023912
Pediatric acute onset neuropsychiatric syndrome	Associate	22139575
Personality Disorders	Associate	15654081, 17429405, 19309535, 19357553, 21295226, 21422455, 21605465, 28031080, 29746646, 31441562, 31448578, 34394296, 35396540, 36536002
Pharyngeal Neoplasms	Associate	25389533
Photophobia	Associate	26035919
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Associate	21422455
Pre Eclampsia	Associate	35695948
Prostatic Neoplasms	Associate	18804811, 22473857, 26499200, 28402333, 28722111, 30021838, 30693539, 30974737, 33513133, 33795839, 36452480, 37403079, 37841082, 37958805
Prostatic Neoplasms Castration Resistant	Associate	28402333, 37403079
Prostatic stromal proliferation of uncertain malignant potential	Associate	25389533
Prostatitis	Associate	37403079
Pyruvate Carboxylase Deficiency Disease	Stimulate	37403079
Sclerosis	Associate	28722111
Seizures	Associate	22365943
Sexual Infantilism	Associate	20364435
Sexual Trauma	Associate	21628708, 22030358, 29600412
Signs and Symptoms	Associate	27045843
Sleep Deprivation	Stimulate	30336354
Sleep Wake Disorders	Associate	17585061
Smoke Inhalation Injury	Associate	19247474
Social Communication Disorder	Associate	30656852
Stomach Neoplasms	Associate	17229543, 33855088, 36915111
Substance Related Disorders	Associate	22552845, 23723362
Tobacco Use Disorder	Associate	18454435
Triple Negative Breast Neoplasms	Associate	23480342, 39529035
Urethral Neoplasms	Associate	36233054
Urinary Bladder Neoplasms	Associate	36233054
Ventricular Dysfunction	Associate	28044091
Virus Diseases	Stimulate	36611805
Wounds and Injuries	Associate	19357553, 23723362

MAOA (monoamine oxidase A)