Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	408
Gene name Gene Name - the full gene name approved by the HGNC.	Arrestin beta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ARRB1
Synonyms (NCBI Gene) Gene synonyms aliases	ARB1, ARR1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.4
Summary Summary of gene provided in NCBI Entrez Gene.	Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory si

Show/Hide all(403)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016808	hsa-miR-335-5p	Microarray	18185580
MIRT027412	hsa-miR-98-5p	Microarray	19088304
MIRT028751	hsa-miR-26b-5p	Microarray	19088304
MIRT049191	hsa-miR-92a-3p	CLASH	23622248
MIRT045162	hsa-miR-186-5p	CLASH	23622248
MIRT438235	hsa-miR-525-3p	Luciferase reporter assay	24147004
MIRT438235	hsa-miR-525-3p	Luciferase reporter assay	24147004
MIRT438235	hsa-miR-525-3p	Luciferase reporter assay	24147004
MIRT438235	hsa-miR-525-3p	Luciferase reporter assay	24147004
MIRT606946	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT606944	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT606947	hsa-miR-223-5p	HITS-CLIP	22927820
MIRT606946	hsa-miR-6867-5p	HITS-CLIP	22927820
MIRT606945	hsa-miR-568	HITS-CLIP	22927820
MIRT606944	hsa-miR-574-5p	HITS-CLIP	22927820
MIRT628431	hsa-miR-4640-3p	HITS-CLIP	23824327
MIRT628430	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT628429	hsa-miR-1470	HITS-CLIP	23824327
MIRT628428	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628427	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT628426	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT628425	hsa-miR-4469	HITS-CLIP	23824327
MIRT628424	hsa-miR-6859-3p	HITS-CLIP	23824327
MIRT628423	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT628422	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT606947	hsa-miR-223-5p	HITS-CLIP	24906430
MIRT606946	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT606945	hsa-miR-568	HITS-CLIP	24906430
MIRT606944	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT606947	hsa-miR-223-5p	HITS-CLIP	24906430
MIRT606946	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT606945	hsa-miR-568	HITS-CLIP	24906430
MIRT606944	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT453510	hsa-miR-4779	PAR-CLIP	23592263
MIRT453509	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT453508	hsa-miR-764	PAR-CLIP	23592263
MIRT453507	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT453506	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT453505	hsa-miR-3913-3p	PAR-CLIP	23592263
MIRT453504	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT453503	hsa-miR-765	PAR-CLIP	23592263
MIRT453502	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT453501	hsa-miR-3175	PAR-CLIP	23592263
MIRT453500	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT453499	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT453498	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT453497	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT453496	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT453495	hsa-miR-6126	PAR-CLIP	23592263
MIRT453494	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT453493	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT606947	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT606945	hsa-miR-568	HITS-CLIP	27418678
MIRT606944	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT606946	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT736327	hsa-miR-7-5p	Luciferase reporter assay, Western blotting	32640511
MIRT606946	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT606944	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT606947	hsa-miR-223-5p	HITS-CLIP	22927820
MIRT606946	hsa-miR-6867-5p	HITS-CLIP	22927820
MIRT606945	hsa-miR-568	HITS-CLIP	22927820
MIRT606944	hsa-miR-574-5p	HITS-CLIP	22927820
MIRT628431	hsa-miR-4640-3p	HITS-CLIP	23824327
MIRT628430	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT628429	hsa-miR-1470	HITS-CLIP	23824327
MIRT628428	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT628427	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT628426	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT628425	hsa-miR-4469	HITS-CLIP	23824327
MIRT628424	hsa-miR-6859-3p	HITS-CLIP	23824327
MIRT628423	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT628422	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT453510	hsa-miR-4779	PAR-CLIP	23592263
MIRT453509	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT453508	hsa-miR-764	PAR-CLIP	23592263
MIRT453507	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT453506	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT453505	hsa-miR-3913-3p	PAR-CLIP	23592263
MIRT453504	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT453503	hsa-miR-765	PAR-CLIP	23592263
MIRT453502	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT453501	hsa-miR-3175	PAR-CLIP	23592263
MIRT453500	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT453499	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT453498	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT453497	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT453496	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT453495	hsa-miR-6126	PAR-CLIP	23592263
MIRT453494	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT453493	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT800512	hsa-miR-1254	CLIP-seq
MIRT800513	hsa-miR-1286	CLIP-seq
MIRT800514	hsa-miR-141	CLIP-seq
MIRT800515	hsa-miR-150	CLIP-seq
MIRT800516	hsa-miR-188-3p	CLIP-seq
MIRT800517	hsa-miR-193a-5p	CLIP-seq
MIRT800518	hsa-miR-200a	CLIP-seq
MIRT800519	hsa-miR-2467-5p	CLIP-seq
MIRT800520	hsa-miR-3116	CLIP-seq
MIRT800521	hsa-miR-3684	CLIP-seq
MIRT800522	hsa-miR-4459	CLIP-seq
MIRT800523	hsa-miR-4468	CLIP-seq
MIRT800524	hsa-miR-4474-3p	CLIP-seq
MIRT800525	hsa-miR-4677-3p	CLIP-seq
MIRT800526	hsa-miR-4679	CLIP-seq
MIRT800527	hsa-miR-4680-5p	CLIP-seq
MIRT800528	hsa-miR-4695-5p	CLIP-seq
MIRT800529	hsa-miR-4713-5p	CLIP-seq
MIRT800530	hsa-miR-4722-5p	CLIP-seq
MIRT800531	hsa-miR-532-3p	CLIP-seq
MIRT800532	hsa-miR-550a	CLIP-seq
MIRT800533	hsa-miR-661	CLIP-seq
MIRT800534	hsa-miR-873	CLIP-seq
MIRT800535	hsa-let-7a	CLIP-seq
MIRT800536	hsa-let-7b	CLIP-seq
MIRT800537	hsa-let-7c	CLIP-seq
MIRT800538	hsa-let-7d	CLIP-seq
MIRT800539	hsa-let-7e	CLIP-seq
MIRT800540	hsa-let-7f	CLIP-seq
MIRT800541	hsa-let-7g	CLIP-seq
MIRT800542	hsa-let-7i	CLIP-seq
MIRT800543	hsa-miR-1207-5p	CLIP-seq
MIRT800544	hsa-miR-1225-3p	CLIP-seq
MIRT800545	hsa-miR-1233	CLIP-seq
MIRT800546	hsa-miR-1256	CLIP-seq
MIRT800547	hsa-miR-1294	CLIP-seq
MIRT800548	hsa-miR-187	CLIP-seq
MIRT800549	hsa-miR-188-5p	CLIP-seq
MIRT800550	hsa-miR-1913	CLIP-seq
MIRT800551	hsa-miR-199a-3p	CLIP-seq
MIRT800552	hsa-miR-199b-3p	CLIP-seq
MIRT800553	hsa-miR-202	CLIP-seq
MIRT800554	hsa-miR-2110	CLIP-seq
MIRT800555	hsa-miR-216a	CLIP-seq
MIRT800556	hsa-miR-217	CLIP-seq
MIRT800557	hsa-miR-224	CLIP-seq
MIRT800558	hsa-miR-2276	CLIP-seq
MIRT800559	hsa-miR-31	CLIP-seq
MIRT800560	hsa-miR-3129-5p	CLIP-seq
MIRT800561	hsa-miR-3144-5p	CLIP-seq
MIRT800562	hsa-miR-3185	CLIP-seq
MIRT800563	hsa-miR-3189-5p	CLIP-seq
MIRT800564	hsa-miR-3191	CLIP-seq
MIRT800565	hsa-miR-324-3p	CLIP-seq
MIRT800566	hsa-miR-361-3p	CLIP-seq
MIRT800567	hsa-miR-3615	CLIP-seq
MIRT800568	hsa-miR-3649	CLIP-seq
MIRT800569	hsa-miR-3657	CLIP-seq
MIRT800570	hsa-miR-3663-5p	CLIP-seq
MIRT800571	hsa-miR-4264	CLIP-seq
MIRT800572	hsa-miR-4293	CLIP-seq
MIRT800573	hsa-miR-431	CLIP-seq
MIRT800574	hsa-miR-4316	CLIP-seq
MIRT800575	hsa-miR-4418	CLIP-seq
MIRT800576	hsa-miR-4436a	CLIP-seq
MIRT800577	hsa-miR-4458	CLIP-seq
MIRT800578	hsa-miR-4500	CLIP-seq
MIRT800579	hsa-miR-4527	CLIP-seq
MIRT800580	hsa-miR-4652-5p	CLIP-seq
MIRT800581	hsa-miR-4668-5p	CLIP-seq
MIRT800582	hsa-miR-4669	CLIP-seq
MIRT800583	hsa-miR-4675	CLIP-seq
MIRT800525	hsa-miR-4677-3p	CLIP-seq
MIRT800584	hsa-miR-4687-5p	CLIP-seq
MIRT800585	hsa-miR-4696	CLIP-seq
MIRT800586	hsa-miR-4701-5p	CLIP-seq
MIRT800587	hsa-miR-4711-3p	CLIP-seq
MIRT800588	hsa-miR-4731-5p	CLIP-seq
MIRT800589	hsa-miR-4736	CLIP-seq
MIRT800590	hsa-miR-4741	CLIP-seq
MIRT800591	hsa-miR-4758-3p	CLIP-seq
MIRT800592	hsa-miR-4763-3p	CLIP-seq
MIRT800593	hsa-miR-4763-5p	CLIP-seq
MIRT800594	hsa-miR-4768-5p	CLIP-seq
MIRT800595	hsa-miR-4797-3p	CLIP-seq
MIRT800596	hsa-miR-489	CLIP-seq
MIRT800597	hsa-miR-490-3p	CLIP-seq
MIRT800598	hsa-miR-509-3-5p	CLIP-seq
MIRT800599	hsa-miR-509-5p	CLIP-seq
MIRT800600	hsa-miR-526b	CLIP-seq
MIRT800601	hsa-miR-577	CLIP-seq
MIRT800602	hsa-miR-588	CLIP-seq
MIRT800603	hsa-miR-617	CLIP-seq
MIRT800604	hsa-miR-659	CLIP-seq
MIRT800605	hsa-miR-665	CLIP-seq
MIRT800606	hsa-miR-936	CLIP-seq
MIRT800607	hsa-miR-942	CLIP-seq
MIRT800608	hsa-miR-98	CLIP-seq
MIRT1936383	hsa-miR-1185	CLIP-seq
MIRT1936384	hsa-miR-1207-3p	CLIP-seq
MIRT800543	hsa-miR-1207-5p	CLIP-seq
MIRT1936385	hsa-miR-1224-3p	CLIP-seq
MIRT800512	hsa-miR-1254	CLIP-seq
MIRT1936386	hsa-miR-125a-5p	CLIP-seq
MIRT1936387	hsa-miR-125b	CLIP-seq
MIRT1936388	hsa-miR-1270	CLIP-seq
MIRT1936389	hsa-miR-1273f	CLIP-seq
MIRT1936390	hsa-miR-1275	CLIP-seq
MIRT800513	hsa-miR-1286	CLIP-seq
MIRT1936391	hsa-miR-148a	CLIP-seq
MIRT1936392	hsa-miR-148b	CLIP-seq
MIRT1936393	hsa-miR-152	CLIP-seq
MIRT1936394	hsa-miR-1825	CLIP-seq
MIRT1936395	hsa-miR-185	CLIP-seq
MIRT800516	hsa-miR-188-3p	CLIP-seq
MIRT1936396	hsa-miR-1909	CLIP-seq
MIRT1936397	hsa-miR-197	CLIP-seq
MIRT1936398	hsa-miR-1976	CLIP-seq
MIRT1936399	hsa-miR-219-1-3p	CLIP-seq
MIRT1936400	hsa-miR-22	CLIP-seq
MIRT800519	hsa-miR-2467-5p	CLIP-seq
MIRT800520	hsa-miR-3116	CLIP-seq
MIRT1936401	hsa-miR-3130-3p	CLIP-seq
MIRT1936402	hsa-miR-3189-3p	CLIP-seq
MIRT1936403	hsa-miR-3192	CLIP-seq
MIRT1936404	hsa-miR-3194-3p	CLIP-seq
MIRT1936405	hsa-miR-323-5p	CLIP-seq
MIRT1936406	hsa-miR-331-3p	CLIP-seq
MIRT1936407	hsa-miR-338-5p	CLIP-seq
MIRT1936408	hsa-miR-339-5p	CLIP-seq
MIRT1936409	hsa-miR-342-5p	CLIP-seq
MIRT1936410	hsa-miR-34b	CLIP-seq
MIRT1936411	hsa-miR-3591-3p	CLIP-seq
MIRT1936412	hsa-miR-3619-3p	CLIP-seq
MIRT800569	hsa-miR-3657	CLIP-seq
MIRT1936413	hsa-miR-3665	CLIP-seq
MIRT1936414	hsa-miR-3679-5p	CLIP-seq
MIRT1936415	hsa-miR-3680	CLIP-seq
MIRT1936416	hsa-miR-3689a-3p	CLIP-seq
MIRT1936417	hsa-miR-3689c	CLIP-seq
MIRT1936418	hsa-miR-3689d	CLIP-seq
MIRT1936419	hsa-miR-3690	CLIP-seq
MIRT1936420	hsa-miR-3714	CLIP-seq
MIRT1936421	hsa-miR-378	CLIP-seq
MIRT1936422	hsa-miR-378b	CLIP-seq
MIRT1936423	hsa-miR-378c	CLIP-seq
MIRT1936424	hsa-miR-378d	CLIP-seq
MIRT1936425	hsa-miR-378e	CLIP-seq
MIRT1936426	hsa-miR-378f	CLIP-seq
MIRT1936427	hsa-miR-378h	CLIP-seq
MIRT1936428	hsa-miR-378i	CLIP-seq
MIRT1936429	hsa-miR-3914	CLIP-seq
MIRT1936430	hsa-miR-3923	CLIP-seq
MIRT1936431	hsa-miR-3940-5p	CLIP-seq
MIRT1936432	hsa-miR-422a	CLIP-seq
MIRT1936433	hsa-miR-4254	CLIP-seq
MIRT1936434	hsa-miR-4260	CLIP-seq
MIRT1936435	hsa-miR-4261	CLIP-seq
MIRT1936436	hsa-miR-4271	CLIP-seq
MIRT1936437	hsa-miR-4279	CLIP-seq
MIRT800572	hsa-miR-4293	CLIP-seq
MIRT1936438	hsa-miR-4306	CLIP-seq
MIRT1936439	hsa-miR-4313	CLIP-seq
MIRT1936440	hsa-miR-4314	CLIP-seq
MIRT1936441	hsa-miR-4319	CLIP-seq
MIRT1936442	hsa-miR-4420	CLIP-seq
MIRT1936443	hsa-miR-4433	CLIP-seq
MIRT800576	hsa-miR-4436a	CLIP-seq
MIRT1936444	hsa-miR-4436b-3p	CLIP-seq
MIRT1936445	hsa-miR-4447	CLIP-seq
MIRT800522	hsa-miR-4459	CLIP-seq
MIRT1936446	hsa-miR-4472	CLIP-seq
MIRT1936447	hsa-miR-4488	CLIP-seq
MIRT1936448	hsa-miR-4492	CLIP-seq
MIRT1936449	hsa-miR-4493	CLIP-seq
MIRT1936450	hsa-miR-4496	CLIP-seq
MIRT1936451	hsa-miR-4498	CLIP-seq
MIRT1936452	hsa-miR-4505	CLIP-seq
MIRT1936453	hsa-miR-4507	CLIP-seq
MIRT1936454	hsa-miR-4644	CLIP-seq
MIRT1936455	hsa-miR-4646-5p	CLIP-seq
MIRT1936456	hsa-miR-4651	CLIP-seq
MIRT1936457	hsa-miR-4653-3p	CLIP-seq
MIRT1936458	hsa-miR-4659a-5p	CLIP-seq
MIRT1936459	hsa-miR-4659b-5p	CLIP-seq
MIRT1936460	hsa-miR-4664-5p	CLIP-seq
MIRT1936461	hsa-miR-4665-5p	CLIP-seq
MIRT800582	hsa-miR-4669	CLIP-seq
MIRT800525	hsa-miR-4677-3p	CLIP-seq
MIRT1936462	hsa-miR-4683	CLIP-seq
MIRT1936463	hsa-miR-4697-5p	CLIP-seq
MIRT1936464	hsa-miR-4716-3p	CLIP-seq
MIRT1936465	hsa-miR-4716-5p	CLIP-seq
MIRT1936466	hsa-miR-4721	CLIP-seq
MIRT800530	hsa-miR-4722-5p	CLIP-seq
MIRT1936467	hsa-miR-4725-3p	CLIP-seq
MIRT1936468	hsa-miR-4728-5p	CLIP-seq
MIRT1936469	hsa-miR-4732-3p	CLIP-seq
MIRT800589	hsa-miR-4736	CLIP-seq
MIRT1936470	hsa-miR-4747-5p	CLIP-seq
MIRT1936471	hsa-miR-4755-5p	CLIP-seq
MIRT1936472	hsa-miR-4756-3p	CLIP-seq
MIRT1936473	hsa-miR-4760-5p	CLIP-seq
MIRT800592	hsa-miR-4763-3p	CLIP-seq
MIRT800593	hsa-miR-4763-5p	CLIP-seq
MIRT1936474	hsa-miR-4768-3p	CLIP-seq
MIRT1936475	hsa-miR-4769-3p	CLIP-seq
MIRT1936476	hsa-miR-4797-5p	CLIP-seq
MIRT1936477	hsa-miR-4798-3p	CLIP-seq
MIRT1936478	hsa-miR-487a	CLIP-seq
MIRT800532	hsa-miR-550a	CLIP-seq
MIRT1936479	hsa-miR-587	CLIP-seq
MIRT1936480	hsa-miR-608	CLIP-seq
MIRT1936481	hsa-miR-615-5p	CLIP-seq
MIRT800603	hsa-miR-617	CLIP-seq
MIRT1936482	hsa-miR-620	CLIP-seq
MIRT1936483	hsa-miR-623	CLIP-seq
MIRT1936484	hsa-miR-625	CLIP-seq
MIRT1936485	hsa-miR-657	CLIP-seq
MIRT800533	hsa-miR-661	CLIP-seq
MIRT1936486	hsa-miR-670	CLIP-seq
MIRT1936487	hsa-miR-762	CLIP-seq
MIRT1936488	hsa-miR-767-3p	CLIP-seq
MIRT1936489	hsa-miR-767-5p	CLIP-seq
MIRT1936490	hsa-miR-876-3p	CLIP-seq
MIRT1936491	hsa-miR-939	CLIP-seq
MIRT2176175	hsa-miR-1253	CLIP-seq
MIRT1936386	hsa-miR-125a-5p	CLIP-seq
MIRT1936387	hsa-miR-125b	CLIP-seq
MIRT2176176	hsa-miR-1269	CLIP-seq
MIRT2176177	hsa-miR-1269b	CLIP-seq
MIRT1936389	hsa-miR-1273f	CLIP-seq
MIRT2176178	hsa-miR-1287	CLIP-seq
MIRT2176179	hsa-miR-1288	CLIP-seq
MIRT2176180	hsa-miR-145	CLIP-seq
MIRT2176181	hsa-miR-146b-3p	CLIP-seq
MIRT2176182	hsa-miR-23a	CLIP-seq
MIRT2176183	hsa-miR-23b	CLIP-seq
MIRT2176184	hsa-miR-23c	CLIP-seq
MIRT2176185	hsa-miR-3135b	CLIP-seq
MIRT2176186	hsa-miR-3173-5p	CLIP-seq
MIRT1936418	hsa-miR-3689d	CLIP-seq
MIRT1936421	hsa-miR-378	CLIP-seq
MIRT1936422	hsa-miR-378b	CLIP-seq
MIRT1936423	hsa-miR-378c	CLIP-seq
MIRT1936424	hsa-miR-378d	CLIP-seq
MIRT1936425	hsa-miR-378e	CLIP-seq
MIRT1936426	hsa-miR-378f	CLIP-seq
MIRT1936427	hsa-miR-378h	CLIP-seq
MIRT1936428	hsa-miR-378i	CLIP-seq
MIRT2176187	hsa-miR-3925-3p	CLIP-seq
MIRT2176188	hsa-miR-3978	CLIP-seq
MIRT1936432	hsa-miR-422a	CLIP-seq
MIRT1936441	hsa-miR-4319	CLIP-seq
MIRT1936442	hsa-miR-4420	CLIP-seq
MIRT1936445	hsa-miR-4447	CLIP-seq
MIRT800522	hsa-miR-4459	CLIP-seq
MIRT1936446	hsa-miR-4472	CLIP-seq
MIRT2176189	hsa-miR-4515	CLIP-seq
MIRT2176190	hsa-miR-4530	CLIP-seq
MIRT2176191	hsa-miR-4740-5p	CLIP-seq
MIRT1936484	hsa-miR-625	CLIP-seq
MIRT800605	hsa-miR-665	CLIP-seq
MIRT2176192	hsa-miR-766	CLIP-seq
MIRT2176193	hsa-miR-874	CLIP-seq
MIRT2176194	hsa-miR-875-3p	CLIP-seq
MIRT1936410	hsa-miR-34b	CLIP-seq
MIRT2176195	hsa-miR-4269	CLIP-seq
MIRT1936442	hsa-miR-4420	CLIP-seq
MIRT1936458	hsa-miR-4659a-5p	CLIP-seq
MIRT1936459	hsa-miR-4659b-5p	CLIP-seq
MIRT2176196	hsa-miR-4733-3p	CLIP-seq
MIRT2176197	hsa-miR-4753-5p	CLIP-seq
MIRT1936475	hsa-miR-4769-3p	CLIP-seq
MIRT2176198	hsa-miR-548aa	CLIP-seq
MIRT2176199	hsa-miR-570	CLIP-seq
MIRT800515	hsa-miR-150	CLIP-seq
MIRT2384485	hsa-miR-635	CLIP-seq
MIRT2426487	hsa-miR-3938	CLIP-seq
MIRT2426488	hsa-miR-4292	CLIP-seq
MIRT2426489	hsa-miR-4308	CLIP-seq
MIRT2426490	hsa-miR-5096	CLIP-seq
MIRT2426491	hsa-miR-637	CLIP-seq
MIRT1936486	hsa-miR-670	CLIP-seq
MIRT1936403	hsa-miR-3192	CLIP-seq
MIRT1936440	hsa-miR-4314	CLIP-seq
MIRT1936455	hsa-miR-4646-5p	CLIP-seq
MIRT2464863	hsa-miR-885-3p	CLIP-seq
MIRT1936386	hsa-miR-125a-5p	CLIP-seq
MIRT1936387	hsa-miR-125b	CLIP-seq
MIRT2479531	hsa-miR-3150b-3p	CLIP-seq
MIRT2479532	hsa-miR-3944-5p	CLIP-seq
MIRT1936441	hsa-miR-4319	CLIP-seq
MIRT1936447	hsa-miR-4488	CLIP-seq
MIRT1936448	hsa-miR-4492	CLIP-seq
MIRT1936451	hsa-miR-4498	CLIP-seq
MIRT2479533	hsa-miR-4689	CLIP-seq
MIRT1936463	hsa-miR-4697-5p	CLIP-seq
MIRT1936466	hsa-miR-4721	CLIP-seq
MIRT1936469	hsa-miR-4732-3p	CLIP-seq
MIRT2479534	hsa-miR-4784	CLIP-seq
MIRT2426491	hsa-miR-637	CLIP-seq
MIRT800533	hsa-miR-661	CLIP-seq
MIRT1936486	hsa-miR-670	CLIP-seq
MIRT1936487	hsa-miR-762	CLIP-seq
MIRT2479531	hsa-miR-3150b-3p	CLIP-seq
MIRT2675440	hsa-miR-3170	CLIP-seq
MIRT2675441	hsa-miR-3616-3p	CLIP-seq
MIRT2479532	hsa-miR-3944-5p	CLIP-seq
MIRT1936444	hsa-miR-4436b-3p	CLIP-seq
MIRT2479533	hsa-miR-4689	CLIP-seq
MIRT1936466	hsa-miR-4721	CLIP-seq
MIRT2479534	hsa-miR-4784	CLIP-seq

Show/Hide all(72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000785	Component	Chromatin	IDA	16325578
GO:0001664	Function	G protein-coupled receptor binding	IBA
GO:0001664	Function	G protein-coupled receptor binding	IDA	37209686, 38175886
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	23633677
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IDA	37209686, 38175886
GO:0002031	Process	G protein-coupled receptor internalization	IBA
GO:0002031	Process	G protein-coupled receptor internalization	IEA
GO:0002031	Process	G protein-coupled receptor internalization	IMP	10521508, 12582207
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IMP	22457824
GO:0003713	Function	Transcription coactivator activity	IMP	16325578
GO:0004402	Function	Histone acetyltransferase activity	IDA	16325578
GO:0004857	Function	Enzyme inhibitor activity	TAS	2163110
GO:0005096	Function	GTPase activator activity	IMP	15611106
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	15878855
GO:0005515	Function	Protein binding	IPI	16189514, 16325578, 16378096, 16432186, 16524428, 17620599, 19202075, 19363159, 19782076, 19879840, 21685944, 21857681, 21988832, 22457824, 23341447, 23353685, 24502978, 24658140, 25416956, 25519916, 26871637, 31515488, 31980649, 32296183, 33961781, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16325578
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10823817, 15611106, 16325578
GO:0005737	Component	Cytoplasm	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9924018
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	16325578
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	23886940
GO:0007165	Process	Signal transduction	IEA
GO:0007600	Process	Sensory perception	IBA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IC	12582207
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IMP	15878855
GO:0016604	Component	Nuclear body	IDA
GO:0019899	Function	Enzyme binding	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031143	Component	Pseudopodium	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	16378096
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	15611106
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	15878855
GO:0031701	Function	Angiotensin receptor binding	IEA
GO:0031701	Function	Angiotensin receptor binding	IPI	15611106
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	16378096
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	16378096
GO:0032717	Process	Negative regulation of interleukin-8 production	IDA	16378096
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IMP	15611106
GO:0042995	Component	Cell projection	IEA
GO:0043149	Process	Stress fiber assembly	IMP	15611106
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	15878855
GO:0045746	Process	Negative regulation of Notch signaling pathway	IBA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IMP	23886940
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16325578
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0060090	Function	Molecular adaptor activity	IC	12582207
GO:0060090	Function	Molecular adaptor activity	IDA	22810587, 37209686, 38175886
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	10644702
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1990763	Function	Arrestin family protein binding	IPI	23886940

MIM	HGNC	e!Ensembl
107940	711	ENSG00000137486

Protein

UniProt ID

P49407

Protein name

Beta-arrestin-1 (Arrestin beta-1) (Non-visual arrestin-2)

Protein function

Functions in regulating agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. During homologous desensitization, beta-arrestins bind to the GPRK-phosphorylated rece

PDB

2IV8 , 6PWC , 6TKO , 6UP7 , 7R0C , 7R0J , 7SRS , 8AS2 , 8AS3 , 8AS4 , 8JRV , 8WRZ , 9II2 , 9II3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00339	Arrestin_N	18 → 174	Arrestin (or S-antigen), N-terminal domain	Domain
PF02752	Arrestin_C	193 → 356	Arrestin (or S-antigen), C-terminal domain	Domain

Sequence

MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR

Sequence length

418

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Chemokine signaling pathway Endocytosis Hedgehog signaling pathway Dopaminergic synapse Olfactory transduction Relaxin signaling pathway Parathyroid hormone synthesis, secretion and action GnRH secretion Morphine addiction Chemical carcinogenesis - receptor activation		G alpha (s) signalling events Lysosome Vesicle Biogenesis Golgi Associated Vesicle Biogenesis Thrombin signalling through proteinase activated receptors (PARs) Activation of SMO MAP2K and MAPK activation Ub-specific processing proteases Signaling by moderate kinase activity BRAF mutants Signaling by high-kinase activity BRAF mutants Signaling by BRAF and RAF fusions Paradoxical activation of RAF signaling by kinase inactive BRAF Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis Signaling downstream of RAS mutants

ARRB1 (arrestin beta 1)