MIR17HG (miR-17-92a-1 cluster host gene)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
407975
Gene name Gene Name - the full gene name approved by the HGNC.
MiR-17-92a-1 cluster host gene
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MIR17HG
Synonyms (NCBI Gene) Gene synonyms aliases
C13orf25, LINC00048, MIHG1, MIRH1, MIRHG1, NCRNA00048, miR-17-92
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q31.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is the host gene for the MIR17-92 cluster, a group of at least six microRNAs (miRNAs) that may be involved in cell survival, proliferation, differentiation, and angiogenesis. Amplification of this gene has been found in several lymphomas and sol
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT019793 hsa-miR-375 Microarray 20215506
MIRT733191 hsa-miR-374a-5p RNA-seq 33552263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0001782 Process B cell homeostasis ISS
GO:0002903 Process Negative regulation of B cell apoptotic process ISS
GO:0003151 Process Outflow tract morphogenesis ISS
GO:0003215 Process Cardiac right ventricle morphogenesis ISS
GO:0014739 Process Positive regulation of muscle hyperplasia IDA 23271053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609415 23564 ENSG00000215417
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q75NE6
Protein name Putative microRNA 17 host gene protein (Putative microRNA host gene 1 protein)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in B-cell lymphoma and lung cancer.
Sequence 
MFCHVDVKISSKRYTWTKLPLNVPKLVLIYLQSHFVLFFFSMCQSIWERPAIGRATTSSA
SWMVGYDCLL
Sequence length 70
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (6)
Causal
Disease term Disease name dbSNP ID References
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)		 28869590
Feingold syndrome Oculodigitoesophagoduodenal syndrome, FEINGOLD SYNDROME 2, Feingold syndrome type 2 rs104893646, rs104893647, rs104893648, rs121913667, rs113994115, rs1558534266, rs574660186, rs1553370260, rs1553370918, rs759103701, rs367962377, rs1553370963, rs754137452, rs780080562, rs1572220856 19344873, 26360630, 21892160
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)		 26360630
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Coronary heart disease Coronary heart disease 28869590 ClinVar
Diabetes Diabetes GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Show/Hide Text Mining Associations (116)
Associations from Text Mining
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 21698185
Adenocarcinoma Associate 23466817
Adenocarcinoma Stimulate 24743967
Adenocarcinoma of Lung Associate 23036707, 37801008
Adenomatous Polyposis Coli Inhibit 26804172
Asthma Associate 31924195
Astrocytoma Associate 33430425
Ataxia Telangiectasia Associate 35710306
Atherosclerosis Associate 26956882
Azoospermia Associate 19210773