MIR17HG (miR-17-92a-1 cluster host gene)

Gene
Gene miRNA Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
407975
Gene name Gene Name - the full gene name approved by the HGNC.
MiR-17-92a-1 cluster host gene
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MIR17HG
Synonyms (NCBI Gene) Gene synonyms aliases
C13orf25, LINC00048, MIHG1, MIRH1, MIRHG1, NCRNA00048, miR-17-92
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q31.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is the host gene for the MIR17-92 cluster, a group of at least six microRNAs (miRNAs) that may be involved in cell survival, proliferation, differentiation, and angiogenesis. Amplification of this gene has been found in several lymphomas and sol
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Other IDs Protein Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT019793 hsa-miR-375 Microarray 20215506
MIRT733191 hsa-miR-374a-5p RNA-seq 33552263
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609415 23564 ENSG00000215417
Protein
Gene miRNA Other IDs Protein Associated diseases
UniProt ID Q75NE6
Protein name Putative microRNA 17 host gene protein (Putative microRNA host gene 1 protein)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in B-cell lymphoma and lung cancer.
Sequence 
MFCHVDVKISSKRYTWTKLPLNVPKLVLIYLQSHFVLFFFSMCQSIWERPAIGRATTSSA
SWMVGYDCLL
Sequence length 70
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes, Type 2 diabetes (PheCode 250.2) N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Show/Hide Text Mining Associations (116)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 21698185
Adenocarcinoma Associate 23466817
Adenocarcinoma Stimulate 24743967
Adenocarcinoma of Lung Associate 23036707, 37801008
Adenomatous Polyposis Coli Inhibit 26804172
Asthma Associate 31924195
Astrocytoma Associate 33430425
Ataxia Telangiectasia Associate 35710306
Atherosclerosis Associate 26956882
Azoospermia Associate 19210773