Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4070
Gene name Gene Name - the full gene name approved by the HGNC.	Tumor associated calcium signal transducer 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TACSTD2
Synonyms (NCBI Gene) Gene synonyms aliases	EGP-1, EGP1, GA733-1, GA7331, GP50, M1S1, TROP2
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p32.1
Summary Summary of gene provided in NCBI Entrez Gene.	This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009]

Show/Hide all(7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs80358223	G>A	Pathogenic	Coding sequence variant, stop gained
rs80358224	G>A	Pathogenic	Coding sequence variant, stop gained
rs80358225	G>T	Pathogenic	Coding sequence variant, stop gained
rs80358226	A>C,G,T	Pathogenic	Initiator codon variant, missense variant
rs80358227	A>T	Pathogenic	Missense variant, coding sequence variant
rs80358228	A>G	Pathogenic	Missense variant, coding sequence variant
rs1569579635	T>-	Pathogenic	Frameshift variant, coding sequence variant

Show/Hide all(143)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001496	hsa-miR-155-5p	pSILAC	18668040
MIRT017057	hsa-miR-335-5p	Microarray	18185580
MIRT001496	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT438121	hsa-miR-125b-1-3p	Luciferase reporter assay	23416980
MIRT438121	hsa-miR-125b-1-3p	Luciferase reporter assay	23416980
MIRT438121	hsa-miR-125b-1-3p	Luciferase reporter assay	23416980
MIRT438121	hsa-miR-125b-1-3p	Luciferase reporter assay	23416980
MIRT1408563	hsa-miR-1180	CLIP-seq
MIRT1408564	hsa-miR-151-3p	CLIP-seq
MIRT1408565	hsa-miR-193a-5p	CLIP-seq
MIRT1408566	hsa-miR-205	CLIP-seq
MIRT1408567	hsa-miR-2115	CLIP-seq
MIRT1408568	hsa-miR-2467-5p	CLIP-seq
MIRT1408569	hsa-miR-299-3p	CLIP-seq
MIRT1408570	hsa-miR-3074-3p	CLIP-seq
MIRT1408571	hsa-miR-3121-3p	CLIP-seq
MIRT1408572	hsa-miR-3121-5p	CLIP-seq
MIRT1408573	hsa-miR-3124-3p	CLIP-seq
MIRT1408574	hsa-miR-3185	CLIP-seq
MIRT1408575	hsa-miR-3188	CLIP-seq
MIRT1408576	hsa-miR-3192	CLIP-seq
MIRT1408577	hsa-miR-3195	CLIP-seq
MIRT1408578	hsa-miR-323-3p	CLIP-seq
MIRT1408579	hsa-miR-323b-5p	CLIP-seq
MIRT1408580	hsa-miR-331-3p	CLIP-seq
MIRT1408581	hsa-miR-34a	CLIP-seq
MIRT1408582	hsa-miR-34c-5p	CLIP-seq
MIRT1408583	hsa-miR-3614-5p	CLIP-seq
MIRT1408584	hsa-miR-3617	CLIP-seq
MIRT1408585	hsa-miR-3646	CLIP-seq
MIRT1408586	hsa-miR-3680	CLIP-seq
MIRT1408587	hsa-miR-374c	CLIP-seq
MIRT1408588	hsa-miR-376c	CLIP-seq
MIRT1408589	hsa-miR-3909	CLIP-seq
MIRT1408590	hsa-miR-3941	CLIP-seq
MIRT1408591	hsa-miR-3975	CLIP-seq
MIRT1408592	hsa-miR-4269	CLIP-seq
MIRT1408593	hsa-miR-4279	CLIP-seq
MIRT1408594	hsa-miR-4314	CLIP-seq
MIRT1408595	hsa-miR-4438	CLIP-seq
MIRT1408596	hsa-miR-4463	CLIP-seq
MIRT1408597	hsa-miR-4491	CLIP-seq
MIRT1408598	hsa-miR-4497	CLIP-seq
MIRT1408599	hsa-miR-4499	CLIP-seq
MIRT1408600	hsa-miR-449a	CLIP-seq
MIRT1408601	hsa-miR-449b	CLIP-seq
MIRT1408602	hsa-miR-4504	CLIP-seq
MIRT1408603	hsa-miR-4514	CLIP-seq
MIRT1408604	hsa-miR-4643	CLIP-seq
MIRT1408605	hsa-miR-4646-5p	CLIP-seq
MIRT1408606	hsa-miR-4657	CLIP-seq
MIRT1408607	hsa-miR-466	CLIP-seq
MIRT1408608	hsa-miR-4664-3p	CLIP-seq
MIRT1408609	hsa-miR-4672	CLIP-seq
MIRT1408610	hsa-miR-4682	CLIP-seq
MIRT1408611	hsa-miR-4692	CLIP-seq
MIRT1408612	hsa-miR-4742-5p	CLIP-seq
MIRT1408613	hsa-miR-4747-3p	CLIP-seq
MIRT1408614	hsa-miR-4789-3p	CLIP-seq
MIRT1408615	hsa-miR-485-3p	CLIP-seq
MIRT1408616	hsa-miR-485-5p	CLIP-seq
MIRT1408617	hsa-miR-488	CLIP-seq
MIRT1408618	hsa-miR-494	CLIP-seq
MIRT1408619	hsa-miR-495	CLIP-seq
MIRT1408620	hsa-miR-516a-3p	CLIP-seq
MIRT1408621	hsa-miR-539	CLIP-seq
MIRT1408622	hsa-miR-641	CLIP-seq
MIRT1408623	hsa-miR-654-3p	CLIP-seq
MIRT1408624	hsa-miR-655	CLIP-seq
MIRT1408625	hsa-miR-873	CLIP-seq
MIRT1408626	hsa-miR-942	CLIP-seq
MIRT2122557	hsa-miR-188-5p	CLIP-seq
MIRT2122558	hsa-miR-1913	CLIP-seq
MIRT1408565	hsa-miR-193a-5p	CLIP-seq
MIRT1408566	hsa-miR-205	CLIP-seq
MIRT1408567	hsa-miR-2115	CLIP-seq
MIRT2122559	hsa-miR-300	CLIP-seq
MIRT2122560	hsa-miR-3074-5p	CLIP-seq
MIRT2122561	hsa-miR-3120-3p	CLIP-seq
MIRT2122562	hsa-miR-3133	CLIP-seq
MIRT2122563	hsa-miR-3189-5p	CLIP-seq
MIRT1408576	hsa-miR-3192	CLIP-seq
MIRT1408577	hsa-miR-3195	CLIP-seq
MIRT1408579	hsa-miR-323b-5p	CLIP-seq
MIRT2122564	hsa-miR-324-3p	CLIP-seq
MIRT2122565	hsa-miR-3613-3p	CLIP-seq
MIRT1408583	hsa-miR-3614-5p	CLIP-seq
MIRT2122566	hsa-miR-3667-3p	CLIP-seq
MIRT2122567	hsa-miR-3671	CLIP-seq
MIRT1408586	hsa-miR-3680	CLIP-seq
MIRT2122568	hsa-miR-381	CLIP-seq
MIRT1408590	hsa-miR-3941	CLIP-seq
MIRT1408593	hsa-miR-4279	CLIP-seq
MIRT1408594	hsa-miR-4314	CLIP-seq
MIRT2122569	hsa-miR-4420	CLIP-seq
MIRT2122570	hsa-miR-4532	CLIP-seq
MIRT1408604	hsa-miR-4643	CLIP-seq
MIRT1408605	hsa-miR-4646-5p	CLIP-seq
MIRT1408607	hsa-miR-466	CLIP-seq
MIRT1408609	hsa-miR-4672	CLIP-seq
MIRT2122571	hsa-miR-4717-5p	CLIP-seq
MIRT2122572	hsa-miR-4758-3p	CLIP-seq
MIRT1408614	hsa-miR-4789-3p	CLIP-seq
MIRT1408615	hsa-miR-485-3p	CLIP-seq
MIRT1408619	hsa-miR-495	CLIP-seq
MIRT1408620	hsa-miR-516a-3p	CLIP-seq
MIRT2122573	hsa-miR-520d-5p	CLIP-seq
MIRT2122574	hsa-miR-524-5p	CLIP-seq
MIRT1408625	hsa-miR-873	CLIP-seq
MIRT1408626	hsa-miR-942	CLIP-seq
MIRT1408569	hsa-miR-299-3p	CLIP-seq
MIRT2122559	hsa-miR-300	CLIP-seq
MIRT2122561	hsa-miR-3120-3p	CLIP-seq
MIRT1408587	hsa-miR-374c	CLIP-seq
MIRT2122568	hsa-miR-381	CLIP-seq
MIRT1408597	hsa-miR-4491	CLIP-seq
MIRT1408606	hsa-miR-4657	CLIP-seq
MIRT1408610	hsa-miR-4682	CLIP-seq
MIRT2344971	hsa-miR-518a-5p	CLIP-seq
MIRT2344972	hsa-miR-527	CLIP-seq
MIRT1408624	hsa-miR-655	CLIP-seq
MIRT2344973	hsa-miR-935	CLIP-seq
MIRT2395495	hsa-miR-1246	CLIP-seq
MIRT1408570	hsa-miR-3074-3p	CLIP-seq
MIRT1408581	hsa-miR-34a	CLIP-seq
MIRT1408582	hsa-miR-34c-5p	CLIP-seq
MIRT2395496	hsa-miR-3614-3p	CLIP-seq
MIRT1408600	hsa-miR-449a	CLIP-seq
MIRT1408601	hsa-miR-449b	CLIP-seq
MIRT2395497	hsa-miR-4503	CLIP-seq
MIRT2395498	hsa-miR-4729	CLIP-seq
MIRT2395499	hsa-miR-513b	CLIP-seq
MIRT1408573	hsa-miR-3124-3p	CLIP-seq
MIRT1408602	hsa-miR-4504	CLIP-seq
MIRT1408569	hsa-miR-299-3p	CLIP-seq
MIRT1408573	hsa-miR-3124-3p	CLIP-seq
MIRT1408587	hsa-miR-374c	CLIP-seq
MIRT1408595	hsa-miR-4438	CLIP-seq
MIRT1408597	hsa-miR-4491	CLIP-seq
MIRT1408602	hsa-miR-4504	CLIP-seq
MIRT1408606	hsa-miR-4657	CLIP-seq
MIRT1408618	hsa-miR-494	CLIP-seq
MIRT1408624	hsa-miR-655	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15607035, 20651236, 32296183
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005829	Component	Cytosol	TAS	10192395
GO:0007601	Process	Visual perception	IEA
GO:0009925	Component	Basal plasma membrane	ISS
GO:0010633	Process	Negative regulation of epithelial cell migration	ISS
GO:0016020	Component	Membrane	TAS	8382772
GO:0016021	Component	Integral component of membrane	IEA
GO:0016328	Component	Lateral plasma membrane	ISS
GO:0050896	Process	Response to stimulus	IEA
GO:0051497	Process	Negative regulation of stress fiber assembly	ISS
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0090191	Process	Negative regulation of branching involved in ureteric bud morphogenesis	ISS
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	ISS
GO:1900028	Process	Negative regulation of ruffle assembly	ISS
GO:2000146	Process	Negative regulation of cell motility	ISS
GO:2000738	Process	Positive regulation of stem cell differentiation	IBA	21873635

MIM	HGNC	e!Ensembl
137290	11530	ENSG00000184292

Protein

UniProt ID

P09758

Protein name

Tumor-associated calcium signal transducer 2 (Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)

Protein function

May function as a growth factor receptor.

PDB

2MAE , 2MVK , 2MVL , 7E5M , 7E5N , 7PEE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00086	Thyroglobulin_1	73 → 145	Thyroglobulin type-1 repeat	Domain

Tissue specificity

TISSUE SPECIFICITY: Placenta, pancreatic carcinoma cell lines.

Sequence

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGS
GMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCN
QTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLF
RERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRG
GLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNR
RKSGKYKKVEIKELGELRKEPSL

Sequence length

323

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Corneal dystrophy	Corneal dystrophy, Corneal dystrophy, Lattice type 3	rs121909212, rs121909214, rs760714959, rs766305306, rs1554579819, rs1554579832, rs1554579878	20454699, 10192395

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Endometriosis	Endometriosis	20864642	ClinVar
Restless Legs Syndrome	Restless Legs Syndrome		GWAS

Show/Hide Text Mining Associations (101)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	16232198, 22482828
Adenocarcinoma	Stimulate	28404926
Adenocarcinoma Bronchiolo Alveolar	Associate	16232198
Adenocarcinoma Follicular	Associate	37505760
Adenocarcinoma of Lung	Associate	16232198, 33882870
Bone Diseases	Associate	32283567
Breast Neoplasms	Associate	23610368, 30268765, 35477165, 35882754, 36302269, 37517589, 37675806, 39837304, 40579360
Calcinosis Cutis	Associate	37344281
Carcinogenesis	Associate	22482828, 28709407
Carcinoma	Associate	23416980, 31969666
Carcinoma	Stimulate	24651436
Carcinoma Endometrioid	Associate	21892093
Carcinoma Hepatocellular	Associate	11768609, 29538454, 30678511, 33882870
Carcinoma Intraductal Noninfiltrating	Stimulate	36577919
Carcinoma Non Small Cell Lung	Associate	22482828
Carcinoma Ovarian Epithelial	Associate	27127000
Carcinoma Pancreatic Ductal	Associate	36878461
Carcinoma Papillary	Associate	21246534, 28547974
Carcinoma Renal Cell	Associate	33882870, 33901032, 35477165
Carcinoma Small Cell	Associate	33901032
Carcinoma Squamous Cell	Associate	22482828, 32854652, 37067548, 39837304
Carcinoma Squamous Cell	Inhibit	24651436
Carcinoma Squamous Cell	Stimulate	35477165
Carcinosarcoma	Associate	22075385
Cell Transformation Neoplastic	Associate	24086649
Cholangiocarcinoma	Associate	33882870
Chordoma	Associate	23533570
Clear cell metastatic renal cell carcinoma	Associate	37344281
Colonic Neoplasms	Associate	23055188
Colorectal Neoplasms	Stimulate	11768609
Colorectal Neoplasms	Associate	18084248, 20473941, 23055188, 26494939, 26600538, 35477165, 36759721, 38063988, 38302503, 39177576
Corneal dystrophy gelatinous drop like	Associate	17167402, 17653040, 19693293, 20454699, 20651236, 20806038, 21541270, 22694960, 23818740
Craniopharyngioma	Associate	37870091
Drug Related Side Effects and Adverse Reactions	Associate	36302269
Endometrial Hyperplasia	Associate	16232198
Epstein Barr Virus Infections	Associate	26617817
Fatty Liver Alcoholic	Associate	29095436
Gallbladder Neoplasms	Associate	25135430
Genetic Diseases Inborn	Associate	17653040
Head and Neck Neoplasms	Associate	23416980
Helicobacter Infections	Stimulate	26716416
Hepatitis C	Associate	29538454
Hepatitis C Chronic	Associate	31146656
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30268765
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	31146656
Infections	Associate	29538454
Intestinal Diseases	Stimulate	38221567
Laryngeal Neoplasms	Stimulate	25779928
Laryngeal Neoplasms	Associate	26600538
Lung Neoplasms	Inhibit	28404926
Lymphatic Metastasis	Stimulate	18813308, 24086649, 25135430, 26716416, 28709407, 30098828
Lymphatic Metastasis	Associate	26600538, 26617817, 28256068
Nasopharyngeal Carcinoma	Associate	26617817
Neoplasm Invasiveness	Associate	25550831
Neoplasm Metastasis	Associate	23958557, 26133168, 26600538, 26617817, 28256068, 33882870, 36153494, 39366934
Neoplasm Metastasis	Stimulate	26716416, 35477165, 38073379
Neoplasms	Associate	18084248, 20473941, 21892093, 22482828, 22539223, 23416980, 23450810, 24086649, 24651436, 24816726, 25135430, 25779928, 26133168, 26296891, 26600538 View all (37 more)
Neoplasms	Inhibit	20699414, 23055188
Neoplasms	Stimulate	27127000, 28709407
Neoplasms Glandular and Epithelial	Associate	28256068, 35477165
Neuroendocrine Tumors	Associate	37344281
Non Muscle Invasive Bladder Neoplasms	Associate	40086591
Osteomalacia	Associate	32283567
Ovarian Diseases	Associate	22075385
Ovarian Neoplasms	Associate	21453957, 37418532
Ovarian Neoplasms	Stimulate	35477165
Paget Disease Extramammary	Associate	34299325
Pancreatic Neoplasms	Associate	18813308, 36878461
Pancreatitis	Stimulate	40474193
Personality Disorders	Associate	22378065
Personality Disorders	Stimulate	30098828
Pituitary Neoplasms	Associate	25550831
Precancerous Conditions	Associate	38221567
Prodromal Symptoms	Stimulate	23055188
Prostate cancer familial	Associate	29095436
Prostatic Neoplasms	Associate	20699414, 23450810, 33009488, 38177207, 40615466
Prostatic Neoplasms	Stimulate	22378065
Prostatitis	Associate	19938015, 20699414
Pulmonary Disease Chronic Obstructive	Stimulate	27887617
Respiratory Tract Infections	Associate	35735421
Retinal Dysplasia	Associate	38221567
Salivary Gland Neoplasms	Associate	33886073
Scleroderma Limited	Associate	27887617
Small Cell Lung Carcinoma	Associate	40064573
Spheroid body myopathy	Associate	20806038
Squamous Cell Carcinoma of Head and Neck	Associate	18084248, 25779928, 30098828, 32854652, 35008509
Stomach Neoplasms	Associate	26716416, 28256068, 31964857, 35477165, 38221567
Tachycardia Atrioventricular Nodal Reentry	Associate	36577919
Tachycardia Atrioventricular Nodal Reentry	Stimulate	40474193
Tarlov Cysts	Stimulate	30098828
Thyroid Cancer Papillary	Associate	26862947, 28547974, 38073379
Thyroid Cancer Papillary	Stimulate	35477165
Thyroid Neoplasms	Associate	26862947
Thyroid Neoplasms	Stimulate	28709407
Triple Negative Breast Neoplasms	Associate	34116144, 36153494, 38092228, 38422473, 39177576, 40474193
Triple Negative Breast Neoplasms	Inhibit	35008509
Tuberculosis Multidrug Resistant	Associate	33515271
Urethral Neoplasms	Associate	33901032, 35216942, 35477165
Urinary Bladder Neoplasms	Associate	29901071, 35216942
Uterine Cervical Neoplasms	Associate	21889762, 24086649, 24816726, 31969666
Uterine Cervicitis	Associate	24816726

TACSTD2 (tumor associated calcium signal transducer 2)