Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4066
Gene name Gene Name - the full gene name approved by the HGNC.	LYL1 basic helix-loop-helix family member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LYL1
Synonyms (NCBI Gene) Gene synonyms aliases	bHLHa18
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has be

Show/Hide all(15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017738	hsa-miR-335-5p	Microarray	18185580
MIRT439123	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439123	hsa-miR-10b-5p	3'LIFE	25074381
MIRT2564326	hsa-miR-3194-3p	CLIP-seq
MIRT2564327	hsa-miR-4659a-5p	CLIP-seq
MIRT2564328	hsa-miR-4659b-5p	CLIP-seq
MIRT2564329	hsa-miR-4716-5p	CLIP-seq
MIRT2564330	hsa-miR-4727-5p	CLIP-seq
MIRT2564331	hsa-miR-4769-3p	CLIP-seq
MIRT2564326	hsa-miR-3194-3p	CLIP-seq
MIRT2564327	hsa-miR-4659a-5p	CLIP-seq
MIRT2564328	hsa-miR-4659b-5p	CLIP-seq
MIRT2564329	hsa-miR-4716-5p	CLIP-seq
MIRT2564330	hsa-miR-4727-5p	CLIP-seq
MIRT2564331	hsa-miR-4769-3p	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
CREB1	Activation	23000483
HOXA1	Unknown	19608273
HOXA10	Unknown	19608273
LMO2	Unknown	19608273
NKX2-5	Unknown	19608273

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001955	Process	Blood vessel maturation	IMP	20418284
GO:0003677	Function	DNA binding	IDA	18160048
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2752424
GO:0005515	Function	Protein binding	IPI	10023675, 18160048
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	10023675
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	18160048
GO:0046983	Function	Protein dimerization activity	IEA
GO:0060216	Process	Definitive hemopoiesis	IEA
GO:0060216	Process	Definitive hemopoiesis	ISS

MIM	HGNC	e!Ensembl
151440	6734	ENSG00000104903

Protein

UniProt ID

P12980

Protein name

Protein lyl-1 (Class A basic helix-loop-helix protein 18) (bHLHa18) (Lymphoblastic leukemia-derived sequence 1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	151 → 203	Helix-loop-helix DNA-binding domain	Domain

Sequence

MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGV
PVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGP
FSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTH
PPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSG
RRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR

Sequence length

280

Interactions

View interactions

	KEGG		Reactome
	Transcriptional misregulation in cancer		NGF-stimulated transcription

LYL1 (LYL1 basic helix-loop-helix family member)