LYL1 (LYL1 basic helix-loop-helix family member)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4066
Gene name Gene Name - the full gene name approved by the HGNC.
LYL1 basic helix-loop-helix family member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LYL1
Synonyms (NCBI Gene) Gene synonyms aliases
bHLHa18
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has be
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
miRTarBase ID miRNA Experiments Reference
MIRT017738 hsa-miR-335-5p Microarray 18185580
MIRT439123 hsa-miR-10b-5p 3'LIFE 25074381
MIRT439123 hsa-miR-10b-5p 3'LIFE 25074381
MIRT2564326 hsa-miR-3194-3p CLIP-seq
MIRT2564327 hsa-miR-4659a-5p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
Transcription factor Regulation Reference
CREB1 Activation 23000483
HOXA1 Unknown 19608273
HOXA10 Unknown 19608273
LMO2 Unknown 19608273
NKX2-5 Unknown 19608273
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001955 Process Blood vessel maturation IMP 20418284
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
151440 6734 ENSG00000104903
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P12980
Protein name Protein lyl-1 (Class A basic helix-loop-helix protein 18) (bHLHa18) (Lymphoblastic leukemia-derived sequence 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 151 → 203 Helix-loop-helix DNA-binding domain Domain
Sequence 
MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGV
PVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGP
FSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTH
PPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSG
RRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
Sequence length 280
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Transcriptional misregulation in cancer   NGF-stimulated transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 16094422
Myelodysplastic syndrome MYELODYSPLASTIC SYNDROME rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587 16094422
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Ataxia Telangiectasia Associate 12086890
Carcinogenesis Associate 2303035
Carcinoma Renal Cell Associate 34402193
Endometrial Neoplasms Associate 29716549
Gliosarcoma Associate 34162346
Leukemia Associate 12086890, 3162254
Leukemia Myeloid Acute Associate 33527899, 34075404, 35842703, 36215477
Lymphoma Large B Cell Diffuse Associate 22517897
Neoplasms Associate 33563042, 35842703
Osteosarcoma Associate 33563042