LYL1 (LYL1 basic helix-loop-helix family member)

Gene

• Entrez ID: 4066
• Gene name: LYL1 basic helix-loop-helix family member
• Gene symbol: LYL1
• Synonyms (NCBI Gene): bHLHa18
• Chromosome: 19
• Chromosome location: 19p13.13
• Summary: This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has be

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017738	hsa-miR-335-5p	Microarray	18185580
MIRT439123	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439123	hsa-miR-10b-5p	3'LIFE	25074381
MIRT2564326	hsa-miR-3194-3p	CLIP-seq
MIRT2564327	hsa-miR-4659a-5p	CLIP-seq
MIRT2564328	hsa-miR-4659b-5p	CLIP-seq
MIRT2564329	hsa-miR-4716-5p	CLIP-seq
MIRT2564330	hsa-miR-4727-5p	CLIP-seq
MIRT2564331	hsa-miR-4769-3p	CLIP-seq
MIRT2564326	hsa-miR-3194-3p	CLIP-seq
MIRT2564327	hsa-miR-4659a-5p	CLIP-seq
MIRT2564328	hsa-miR-4659b-5p	CLIP-seq
MIRT2564329	hsa-miR-4716-5p	CLIP-seq
MIRT2564330	hsa-miR-4727-5p	CLIP-seq
MIRT2564331	hsa-miR-4769-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Activation	23000483
HOXA1	Unknown	19608273
HOXA10	Unknown	19608273
LMO2	Unknown	19608273
NKX2-5	Unknown	19608273

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001955	Process	Blood vessel maturation	IMP	20418284
GO:0003677	Function	DNA binding	IDA	18160048
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2752424
GO:0005515	Function	Protein binding	IPI	10023675, 18160048
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	10023675
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030183	Process	B cell differentiation	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	18160048
GO:0046983	Function	Protein dimerization activity	IEA
GO:0060216	Process	Definitive hemopoiesis	IEA
GO:0060216	Process	Definitive hemopoiesis	ISS

Other IDs

• MIM: 151440
• HGNC: 6734
• e!Ensembl: ENSG00000104903

Protein

• UniProt ID: P12980
• Protein name: Protein lyl-1 (Class A basic helix-loop-helix protein 18) (bHLHa18) (Lymphoblastic leukemia-derived sequence 1)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	151 → 203	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGV
  PVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGP
  FSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTH
  PPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSG
  RRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR

• Sequence length: 280

Pathways

KEGG:

Transcriptional misregulation in cancer

Reactome:

NGF-stimulated transcription