Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4060
Gene name Gene Name - the full gene name approved by the HGNC.	Lumican
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LUM
Synonyms (NCBI Gene) Gene synonyms aliases	LDC, SLRR2D
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q21.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly

Show/Hide all(101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT735118	hsa-miR-450b-5p	qRT-PCR	31776299
MIRT1122429	hsa-miR-4282	CLIP-seq
MIRT1122430	hsa-miR-4330	CLIP-seq
MIRT1122431	hsa-miR-4760-3p	CLIP-seq
MIRT1122432	hsa-miR-490-5p	CLIP-seq
MIRT1122433	hsa-miR-548a-3p	CLIP-seq
MIRT1122434	hsa-miR-548e	CLIP-seq
MIRT1122435	hsa-miR-548f	CLIP-seq
MIRT1122436	hsa-miR-570	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT1550995	hsa-miR-4477a	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT2265158	hsa-miR-128	CLIP-seq
MIRT2430857	hsa-miR-21	CLIP-seq
MIRT2430858	hsa-miR-2116	CLIP-seq
MIRT2430859	hsa-miR-2964a-5p	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT2430861	hsa-miR-325	CLIP-seq
MIRT2430862	hsa-miR-3924	CLIP-seq
MIRT2430863	hsa-miR-4311	CLIP-seq
MIRT2430864	hsa-miR-4422	CLIP-seq
MIRT1550995	hsa-miR-4477a	CLIP-seq
MIRT2430865	hsa-miR-4677-5p	CLIP-seq
MIRT2430866	hsa-miR-4696	CLIP-seq
MIRT2430867	hsa-miR-4757-5p	CLIP-seq
MIRT2430868	hsa-miR-4777-5p	CLIP-seq
MIRT2430869	hsa-miR-4796-5p	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT2430870	hsa-miR-494	CLIP-seq
MIRT2430871	hsa-miR-507	CLIP-seq
MIRT2430872	hsa-miR-518d-5p	CLIP-seq
MIRT2430873	hsa-miR-519b-5p	CLIP-seq
MIRT2430874	hsa-miR-519c-5p	CLIP-seq
MIRT2430875	hsa-miR-520c-5p	CLIP-seq
MIRT2430876	hsa-miR-520d-5p	CLIP-seq
MIRT2430877	hsa-miR-524-5p	CLIP-seq
MIRT2430878	hsa-miR-526a	CLIP-seq
MIRT2430879	hsa-miR-557	CLIP-seq
MIRT2430880	hsa-miR-561	CLIP-seq
MIRT2430881	hsa-miR-578	CLIP-seq
MIRT2430882	hsa-miR-581	CLIP-seq
MIRT2430883	hsa-miR-590-5p	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2430884	hsa-miR-802	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2564137	hsa-miR-1245b-5p	CLIP-seq
MIRT2430858	hsa-miR-2116	CLIP-seq
MIRT2430859	hsa-miR-2964a-5p	CLIP-seq
MIRT2564138	hsa-miR-3142	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT2430864	hsa-miR-4422	CLIP-seq
MIRT2564139	hsa-miR-4446-5p	CLIP-seq
MIRT2564140	hsa-miR-4645-3p	CLIP-seq
MIRT2430865	hsa-miR-4677-5p	CLIP-seq
MIRT2564141	hsa-miR-4755-5p	CLIP-seq
MIRT2564142	hsa-miR-4763-5p	CLIP-seq
MIRT2430869	hsa-miR-4796-5p	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT2564143	hsa-miR-513a-3p	CLIP-seq
MIRT2430876	hsa-miR-520d-5p	CLIP-seq
MIRT2430877	hsa-miR-524-5p	CLIP-seq
MIRT2430881	hsa-miR-578	CLIP-seq
MIRT2430882	hsa-miR-581	CLIP-seq
MIRT2564144	hsa-miR-642a	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2564145	hsa-miR-665	CLIP-seq
MIRT2564146	hsa-miR-936	CLIP-seq
MIRT2564137	hsa-miR-1245b-5p	CLIP-seq
MIRT2430857	hsa-miR-21	CLIP-seq
MIRT2430858	hsa-miR-2116	CLIP-seq
MIRT2430859	hsa-miR-2964a-5p	CLIP-seq
MIRT2564138	hsa-miR-3142	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT2430861	hsa-miR-325	CLIP-seq
MIRT2430862	hsa-miR-3924	CLIP-seq
MIRT1122429	hsa-miR-4282	CLIP-seq
MIRT2684296	hsa-miR-4307	CLIP-seq
MIRT1122430	hsa-miR-4330	CLIP-seq
MIRT2430864	hsa-miR-4422	CLIP-seq
MIRT2564139	hsa-miR-4446-5p	CLIP-seq
MIRT1550995	hsa-miR-4477a	CLIP-seq
MIRT2564140	hsa-miR-4645-3p	CLIP-seq
MIRT2430865	hsa-miR-4677-5p	CLIP-seq
MIRT2564141	hsa-miR-4755-5p	CLIP-seq
MIRT1122431	hsa-miR-4760-3p	CLIP-seq
MIRT2564142	hsa-miR-4763-5p	CLIP-seq
MIRT2430869	hsa-miR-4796-5p	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT1122432	hsa-miR-490-5p	CLIP-seq
MIRT2564143	hsa-miR-513a-3p	CLIP-seq
MIRT2430876	hsa-miR-520d-5p	CLIP-seq
MIRT2430877	hsa-miR-524-5p	CLIP-seq
MIRT2430881	hsa-miR-578	CLIP-seq
MIRT2430882	hsa-miR-581	CLIP-seq
MIRT2430883	hsa-miR-590-5p	CLIP-seq
MIRT2564144	hsa-miR-642a	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2564145	hsa-miR-665	CLIP-seq
MIRT2564146	hsa-miR-936	CLIP-seq

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	NAS	10892350
GO:0005515	Function	Protein binding	IPI	25304424, 32814053
GO:0005518	Function	Collagen binding	IBA	21873635
GO:0005518	Function	Collagen binding	IDA	10892350
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005583	Component	Fibrillar collagen trimer	IDA	10734230
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005796	Component	Golgi lumen	TAS
GO:0007601	Process	Visual perception	IEA
GO:0014070	Process	Response to organic cyclic compound	IEA
GO:0018146	Process	Keratan sulfate biosynthetic process	TAS
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	ISS
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	20551380, 25037231, 27559042, 28675934
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030199	Process	Collagen fibril organization	NAS	10892350
GO:0031012	Component	Extracellular matrix	TAS	7665616
GO:0032914	Process	Positive regulation of transforming growth factor beta1 production	IEA
GO:0042340	Process	Keratan sulfate catabolic process	TAS
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	25037231, 27559042, 28675934
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	20551380
GO:0062023	Component	Collagen-containing extracellular matrix	ISS	22261194
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070848	Process	Response to growth factor	IEA

MIM	HGNC	e!Ensembl
600616	6724	ENSG00000139329

Protein

UniProt ID

P51884

Protein name

Lumican (Keratan sulfate proteoglycan lumican) (KSPG lumican)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01462	LRRNT	36 → 66	Leucine rich repeat N-terminal domain	Family
PF13855	LRR_8	67 → 102	Leucine rich repeat	Repeat
PF13855	LRR_8	136 → 171	Leucine rich repeat	Repeat
PF13516	LRR_6	182 → 197	Leucine Rich repeat	Repeat
PF13855	LRR_8	205 → 266	Leucine rich repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Cornea and other tissues.

Sequence

MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
KGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP
LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

Sequence length

338

Interactions

View interactions

	KEGG		Reactome
	Proteoglycans in cancer		Keratan sulfate biosynthesis Keratan sulfate degradation Integrin cell surface interactions Defective CHST6 causes MCDC1 Defective ST3GAL3 causes MCT12 and EIEE15 Defective B4GALT1 causes B4GALT1-CDG (CDG-2d)

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Facioscapulohumeral muscular dystrophy	Muscular Dystrophy, Facioscapulohumeral	rs387907319, rs397514623, rs1057519614, rs1598416221, rs886041918, rs886042417, rs1057519644, rs1245372794, rs1555642277, rs1555644339, rs1555647265, rs886044369, rs1568350731, rs377471712, rs2075161300, rs2075566961, rs2075161499 View all (2 more)	12868502

Show/Hide Text Mining Associations (89)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Aortic Syndrome	Associate	22228989, 27403433
Adenocarcinoma	Associate	25961303, 38250763
Adenocarcinoma of Lung	Associate	25961303
Aneuploidy	Inhibit	31760859
Aneurysm	Stimulate	29929532
Aortic Dissection	Associate	22228989
Aortic Valve Stenosis	Associate	26742884
Ascites	Associate	27500424
Atherosclerosis	Associate	15970583
Bone Cysts Aneurysmal	Associate	32859633
Brain Injuries Diffuse	Associate	40063067
Brain Neoplasms	Associate	31888563
Breast Neoplasms	Associate	19036156, 28332606, 32160387
Carcinogenesis	Associate	12927043, 18827816, 31760859
Carcinoma Hepatocellular	Associate	34664394
Carcinoma Ovarian Epithelial	Inhibit	21637745
Carcinoma Renal Cell	Associate	27319973
Cardiomyopathies	Associate	36863704
Cartilage Diseases	Stimulate	31715293
Chondrosarcoma	Associate	32705211
Colonic Neoplasms	Stimulate	22711178, 28481899
Colonic Neoplasms	Associate	33493133
Colorectal Neoplasms	Associate	22711178, 33422939
Corneal Dystrophy Posterior Amorphous	Associate	24759697, 29671669
Diabetes Mellitus	Stimulate	32453760
Diabetes Mellitus Type 1	Stimulate	18092746
Diabetic Nephropathies	Associate	33568476, 33887734, 34557161
Endometriosis	Associate	32964764
Epiretinal Membrane	Associate	35571611
Erythema elevatum diutinum	Associate	33887734
Esophageal Squamous Cell Carcinoma	Associate	39256753
Exfoliation Syndrome	Associate	37108678
Fatty Liver	Associate	19330863
Fibrocartilaginous embolism	Associate	34516336
Fibrosis	Associate	26709788, 32386798, 40443657
Glaucoma Open Angle	Associate	16565384
Glioblastoma	Associate	26230845, 38286983
Heart Failure	Associate	36254001
Hepatitis B Chronic	Associate	26709788
Hereditary Breast and Ovarian Cancer Syndrome	Associate	12927043
Hypertrophy	Associate	40443657
Inflammation	Associate	31715293, 34516336
Insulin Resistance	Associate	32293066
Intervertebral Disc Degeneration	Associate	32873329, 34516336
Intervertebral disc disease	Associate	34516336
Keratoconus	Associate	23727491
Lung Neoplasms	Associate	29549325
Lung Neoplasms	Stimulate	31760859
Lupus Nephritis	Stimulate	35967373
Lymphangioleiomyomatosis	Associate	34312290
Lymphatic Metastasis	Stimulate	31888563
Lymphoma Non Hodgkin	Associate	15592176
Macular Degeneration	Associate	30404605, 35186229
Melanoma	Associate	17050378, 24098450
Mitral Valve Prolapse Myxomatous 1	Associate	28121998
Myopia	Associate	15592176, 16902402, 31776299
Neoplasm Metastasis	Associate	17050378, 18093185, 27993815, 31760859, 38183115
Neoplasm Metastasis	Stimulate	33493133
Neoplasms	Associate	16908595, 17050378, 19036156, 22711178, 26230845, 27319973, 28481899, 31760859, 33493133, 35874760, 36619896, 37108678, 38129820, 40076915
Neoplasms	Inhibit	24098450
Neoplastic Cells Circulating	Associate	34664394
Neuroblastoma	Associate	26230845, 31861249, 37947594
Non alcoholic Fatty Liver Disease	Associate	19330863, 29769552, 32386798
Non Muscle Invasive Bladder Neoplasms	Associate	32786144, 33035117
Obesity	Associate	19330863, 32293066
Osteoarthritis	Stimulate	31715293
Osteoporosis	Associate	39383820
Osteosarcoma	Associate	18093185
Ovarian Neoplasms	Associate	24804215, 32319226, 35874760
Pancreatic Neoplasms	Associate	19843670, 22316387
Pelvic Organ Prolapse	Associate	29630675
Pituitary Neoplasms	Associate	36686480
Pleural Effusion	Associate	25961303
Polycystic Ovary Syndrome	Associate	28789706
Polyposis Syndrome Hereditary Mixed 1	Associate	28481899
Pre Eclampsia	Associate	35035521
Precancerous Conditions	Inhibit	33493133
Prostatic Neoplasms	Associate	37108678
Pulmonary Fibrosis	Stimulate	26038391
Respiratory Distress Syndrome	Associate	40063067
Rheumatic Diseases	Associate	31715293
Rheumatic Heart Disease	Associate	28121998
Status Asthmaticus	Associate	14523040
Stomach Neoplasms	Associate	18827816
Stomach Neoplasms	Stimulate	38129820
Tetralogy of Fallot	Inhibit	23571024
Tetralogy of Fallot	Stimulate	32805183
Urinary Bladder Neoplasms	Associate	28459201, 33035117
Ventricular Remodeling	Associate	23571024

LUM (lumican)