LUM (lumican)

Gene

• Entrez ID: 4060
• Gene name: Lumican
• Gene symbol: LUM
• Synonyms (NCBI Gene): LDC, SLRR2D
• Chromosome: 12
• Chromosome location: 12q21.33
• Summary: This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT735118	hsa-miR-450b-5p	qRT-PCR	31776299
MIRT1122429	hsa-miR-4282	CLIP-seq
MIRT1122430	hsa-miR-4330	CLIP-seq
MIRT1122431	hsa-miR-4760-3p	CLIP-seq
MIRT1122432	hsa-miR-490-5p	CLIP-seq
MIRT1122433	hsa-miR-548a-3p	CLIP-seq
MIRT1122434	hsa-miR-548e	CLIP-seq
MIRT1122435	hsa-miR-548f	CLIP-seq
MIRT1122436	hsa-miR-570	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT1550995	hsa-miR-4477a	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT2265158	hsa-miR-128	CLIP-seq
MIRT2430857	hsa-miR-21	CLIP-seq
MIRT2430858	hsa-miR-2116	CLIP-seq
MIRT2430859	hsa-miR-2964a-5p	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT2430861	hsa-miR-325	CLIP-seq
MIRT2430862	hsa-miR-3924	CLIP-seq
MIRT2430863	hsa-miR-4311	CLIP-seq
MIRT2430864	hsa-miR-4422	CLIP-seq
MIRT1550995	hsa-miR-4477a	CLIP-seq
MIRT2430865	hsa-miR-4677-5p	CLIP-seq
MIRT2430866	hsa-miR-4696	CLIP-seq
MIRT2430867	hsa-miR-4757-5p	CLIP-seq
MIRT2430868	hsa-miR-4777-5p	CLIP-seq
MIRT2430869	hsa-miR-4796-5p	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT2430870	hsa-miR-494	CLIP-seq
MIRT2430871	hsa-miR-507	CLIP-seq
MIRT2430872	hsa-miR-518d-5p	CLIP-seq
MIRT2430873	hsa-miR-519b-5p	CLIP-seq
MIRT2430874	hsa-miR-519c-5p	CLIP-seq
MIRT2430875	hsa-miR-520c-5p	CLIP-seq
MIRT2430876	hsa-miR-520d-5p	CLIP-seq
MIRT2430877	hsa-miR-524-5p	CLIP-seq
MIRT2430878	hsa-miR-526a	CLIP-seq
MIRT2430879	hsa-miR-557	CLIP-seq
MIRT2430880	hsa-miR-561	CLIP-seq
MIRT2430881	hsa-miR-578	CLIP-seq
MIRT2430882	hsa-miR-581	CLIP-seq
MIRT2430883	hsa-miR-590-5p	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2430884	hsa-miR-802	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2564137	hsa-miR-1245b-5p	CLIP-seq
MIRT2430858	hsa-miR-2116	CLIP-seq
MIRT2430859	hsa-miR-2964a-5p	CLIP-seq
MIRT2564138	hsa-miR-3142	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT2430864	hsa-miR-4422	CLIP-seq
MIRT2564139	hsa-miR-4446-5p	CLIP-seq
MIRT2564140	hsa-miR-4645-3p	CLIP-seq
MIRT2430865	hsa-miR-4677-5p	CLIP-seq
MIRT2564141	hsa-miR-4755-5p	CLIP-seq
MIRT2564142	hsa-miR-4763-5p	CLIP-seq
MIRT2430869	hsa-miR-4796-5p	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT2564143	hsa-miR-513a-3p	CLIP-seq
MIRT2430876	hsa-miR-520d-5p	CLIP-seq
MIRT2430877	hsa-miR-524-5p	CLIP-seq
MIRT2430881	hsa-miR-578	CLIP-seq
MIRT2430882	hsa-miR-581	CLIP-seq
MIRT2564144	hsa-miR-642a	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2564145	hsa-miR-665	CLIP-seq
MIRT2564146	hsa-miR-936	CLIP-seq
MIRT2564137	hsa-miR-1245b-5p	CLIP-seq
MIRT2430857	hsa-miR-21	CLIP-seq
MIRT2430858	hsa-miR-2116	CLIP-seq
MIRT2430859	hsa-miR-2964a-5p	CLIP-seq
MIRT2564138	hsa-miR-3142	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT2430861	hsa-miR-325	CLIP-seq
MIRT2430862	hsa-miR-3924	CLIP-seq
MIRT1122429	hsa-miR-4282	CLIP-seq
MIRT2684296	hsa-miR-4307	CLIP-seq
MIRT1122430	hsa-miR-4330	CLIP-seq
MIRT2430864	hsa-miR-4422	CLIP-seq
MIRT2564139	hsa-miR-4446-5p	CLIP-seq
MIRT1550995	hsa-miR-4477a	CLIP-seq
MIRT2564140	hsa-miR-4645-3p	CLIP-seq
MIRT2430865	hsa-miR-4677-5p	CLIP-seq
MIRT2564141	hsa-miR-4755-5p	CLIP-seq
MIRT1122431	hsa-miR-4760-3p	CLIP-seq
MIRT2564142	hsa-miR-4763-5p	CLIP-seq
MIRT2430869	hsa-miR-4796-5p	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT1122432	hsa-miR-490-5p	CLIP-seq
MIRT2564143	hsa-miR-513a-3p	CLIP-seq
MIRT2430876	hsa-miR-520d-5p	CLIP-seq
MIRT2430877	hsa-miR-524-5p	CLIP-seq
MIRT2430881	hsa-miR-578	CLIP-seq
MIRT2430882	hsa-miR-581	CLIP-seq
MIRT2430883	hsa-miR-590-5p	CLIP-seq
MIRT2564144	hsa-miR-642a	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2564145	hsa-miR-665	CLIP-seq
MIRT2564146	hsa-miR-936	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	NAS	10892350
GO:0005515	Function	Protein binding	IPI	25304424, 32814053
GO:0005518	Function	Collagen binding	IBA
GO:0005518	Function	Collagen binding	IDA	10892350
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005583	Component	Fibrillar collagen trimer	IDA	10734230
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	TAS
GO:0007601	Process	Visual perception	TAS	10802664
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	ISS
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	20551380, 25037231, 27559042, 28675934
GO:0030199	Process	Collagen fibril organization	NAS	10892350
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27559042, 28675934
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0031012	Component	Extracellular matrix	TAS	7665616
GO:0032914	Process	Positive regulation of transforming growth factor beta1 production	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070848	Process	Response to growth factor	IEA
GO:1904010	Process	Response to Aroclor 1254	IEA

Other IDs

• MIM: 600616
• HGNC: 6724
• e!Ensembl: ENSG00000139329

Protein

• UniProt ID: P51884
• Protein name: Lumican (Keratan sulfate proteoglycan lumican) (KSPG lumican)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01462	LRRNT	36 → 66	Leucine rich repeat N-terminal domain	Family
  PF13855	LRR_8	67 → 102	Leucine rich repeat	Repeat
  PF13855	LRR_8	136 → 171	Leucine rich repeat	Repeat
  PF13516	LRR_6	182 → 197	Leucine Rich repeat	Repeat
  PF13855	LRR_8	205 → 266	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Cornea and other tissues.
• Sequence:

  MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
  VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
  LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
  KGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
  LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP
  LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

• Sequence length: 338

Pathways

KEGG:

Proteoglycans in cancer

Reactome:

Keratan sulfate biosynthesis
Keratan sulfate degradation
Integrin cell surface interactions
Defective CHST6 causes MCDC1
Defective ST3GAL3 causes MCT12 and EIEE15
Defective B4GALT1 causes B4GALT1-CDG (CDG-2d)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CAROTID ARTERY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUM-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Acute Aortic Syndrome	Associate	22228989, 27403433	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	25961303, 38250763	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	25961303	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Inhibit	31760859	★☆☆☆☆ Found in Text Mining only
Aneurysm	Stimulate	29929532	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Associate	22228989	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Associate	26742884	★☆☆☆☆ Found in Text Mining only
Ascites	Associate	27500424	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	15970583	★☆☆☆☆ Found in Text Mining only
Bone Cysts Aneurysmal	Associate	32859633	★☆☆☆☆ Found in Text Mining only
Brain Injuries Diffuse	Associate	40063067	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	31888563	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	19036156, 28332606, 32160387	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	12927043, 18827816, 31760859	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	34664394	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Inhibit	21637745	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	27319973	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Associate	36863704	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Stimulate	31715293	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Associate	32705211	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Stimulate	22711178, 28481899	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	33493133	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	22711178, 33422939	★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Posterior Amorphous	Associate	24759697, 29671669	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	32453760	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Stimulate	18092746	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	33568476, 33887734, 34557161	★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	32964764	★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Associate	35571611	★☆☆☆☆ Found in Text Mining only
Erythema elevatum diutinum	Associate	33887734	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	39256753	★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Associate	37108678	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	19330863	★☆☆☆☆ Found in Text Mining only
Fibrocartilaginous embolism	Associate	34516336	★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	26709788, 32386798, 40443657	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Associate	16565384	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	26230845, 38286983	★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	36254001	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Associate	26709788	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	12927043	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Associate	40443657	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	31715293, 34516336	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	32293066	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	32873329, 34516336	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Associate	34516336	★☆☆☆☆ Found in Text Mining only
Keratoconus	Associate	23727491	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	29549325	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	31760859	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Stimulate	35967373	★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Associate	34312290	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	31888563	★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	15592176	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Associate	30404605, 35186229	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	17050378, 24098450	★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Myxomatous 1	Associate	28121998	★☆☆☆☆ Found in Text Mining only
Myopia	Associate	15592176, 16902402, 31776299	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	17050378, 18093185, 27993815, 31760859, 38183115	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	33493133	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16908595, 17050378, 19036156, 22711178, 26230845, 27319973, 28481899, 31760859, 33493133, 35874760, 36619896, 37108678, 38129820, 40076915	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	24098450	★☆☆☆☆ Found in Text Mining only
Neoplastic Cells Circulating	Associate	34664394	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	26230845, 31861249, 37947594	★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	19330863, 29769552, 32386798	★☆☆☆☆ Found in Text Mining only
Non Muscle Invasive Bladder Neoplasms	Associate	32786144, 33035117	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	19330863, 32293066	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Stimulate	31715293	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Associate	39383820	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	18093185	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	24804215, 32319226, 35874760	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	19843670, 22316387	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Associate	29630675	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Associate	36686480	★☆☆☆☆ Found in Text Mining only
Pleural Effusion	Associate	25961303	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	28789706	★☆☆☆☆ Found in Text Mining only
Polyposis Syndrome Hereditary Mixed 1	Associate	28481899	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Associate	35035521	★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Inhibit	33493133	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	37108678	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Stimulate	26038391	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Associate	40063067	★☆☆☆☆ Found in Text Mining only
Rheumatic Diseases	Associate	31715293	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Associate	28121998	★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Associate	14523040	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	18827816	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stimulate	38129820	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Inhibit	23571024	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Stimulate	32805183	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	28459201, 33035117	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Associate	23571024	★☆☆☆☆ Found in Text Mining only