Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4055
Gene name	Lymphotoxin beta receptor
Gene symbol	LTBR
Synonyms (NCBI Gene)	D12S370LT-BETA-RTNF-R-IIITNFCRTNFR-RPTNFR2-RPTNFR3TNFRSF3
Chromosome	12
Chromosome location	12p13.31
Summary	This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during t

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027696	hsa-miR-98-5p	Microarray	19088304
MIRT641725	hsa-miR-9500	HITS-CLIP	23824327
MIRT641724	hsa-miR-454-5p	HITS-CLIP	23824327
MIRT641723	hsa-miR-4533	HITS-CLIP	23824327
MIRT641722	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT641721	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT641720	hsa-miR-6883-3p	HITS-CLIP	23824327
MIRT734365	hsa-miR-29a-3p	Luciferase reporter assayWestern blotting	33602223
MIRT641725	hsa-miR-9500	HITS-CLIP	23824327
MIRT641724	hsa-miR-454-5p	HITS-CLIP	23824327
MIRT641723	hsa-miR-4533	HITS-CLIP	23824327
MIRT641722	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT641721	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT641720	hsa-miR-6883-3p	HITS-CLIP	23824327
MIRT1122183	hsa-miR-1182	CLIP-seq
MIRT1122184	hsa-miR-1255a	CLIP-seq
MIRT1122185	hsa-miR-1255b	CLIP-seq
MIRT1122186	hsa-miR-1273g	CLIP-seq
MIRT1122187	hsa-miR-127-5p	CLIP-seq
MIRT1122188	hsa-miR-1909	CLIP-seq
MIRT1122189	hsa-miR-2110	CLIP-seq
MIRT1122190	hsa-miR-29a	CLIP-seq
MIRT1122191	hsa-miR-29b	CLIP-seq
MIRT1122192	hsa-miR-29c	CLIP-seq
MIRT1122193	hsa-miR-3150a-3p	CLIP-seq
MIRT1122194	hsa-miR-3190	CLIP-seq
MIRT1122195	hsa-miR-338-5p	CLIP-seq
MIRT1122196	hsa-miR-3616-5p	CLIP-seq
MIRT1122197	hsa-miR-3647-5p	CLIP-seq
MIRT1122198	hsa-miR-3663-3p	CLIP-seq
MIRT1122199	hsa-miR-3911	CLIP-seq
MIRT1122200	hsa-miR-3921	CLIP-seq
MIRT1122201	hsa-miR-409-5p	CLIP-seq
MIRT1122202	hsa-miR-4450	CLIP-seq
MIRT1122203	hsa-miR-4453	CLIP-seq
MIRT1122204	hsa-miR-4538	CLIP-seq
MIRT1122205	hsa-miR-455-3p	CLIP-seq
MIRT1122206	hsa-miR-4653-5p	CLIP-seq
MIRT1122207	hsa-miR-4795-5p	CLIP-seq
MIRT1122208	hsa-miR-573	CLIP-seq
MIRT1122209	hsa-miR-593	CLIP-seq
MIRT1122210	hsa-miR-595	CLIP-seq
MIRT1122183	hsa-miR-1182	CLIP-seq
MIRT2034530	hsa-miR-1250	CLIP-seq
MIRT1122186	hsa-miR-1273g	CLIP-seq
MIRT1122188	hsa-miR-1909	CLIP-seq
MIRT2034531	hsa-miR-1910	CLIP-seq
MIRT1122195	hsa-miR-338-5p	CLIP-seq
MIRT1122201	hsa-miR-409-5p	CLIP-seq
MIRT2034532	hsa-miR-4264	CLIP-seq
MIRT2034533	hsa-miR-4469	CLIP-seq
MIRT1122205	hsa-miR-455-3p	CLIP-seq
MIRT2034534	hsa-miR-4655-3p	CLIP-seq
MIRT2034535	hsa-miR-4777-3p	CLIP-seq
MIRT1122195	hsa-miR-338-5p	CLIP-seq
MIRT2264990	hsa-miR-4659a-5p	CLIP-seq
MIRT2264991	hsa-miR-4659b-5p	CLIP-seq
MIRT2264992	hsa-miR-4776-3p	CLIP-seq
MIRT2390395	hsa-miR-1915	CLIP-seq
MIRT2390396	hsa-miR-4323	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
WWTR1	Activation	22470139

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	8995654, 12393901, 20732415, 26977880, 28514442, 29329668, 32296183, 33961781
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	8171323
GO:0016020	Component	Membrane	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0042802	Function	Identical protein binding	IPI	20732415
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0046330	Process	Positive regulation of JNK cascade	IMP	20732415
GO:0048534	Process	Hematopoietic or lymphoid organ development	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	20732415

MIM	HGNC	e!Ensembl
600979	6718	ENSG00000111321

P36941

Protein name

Tumor necrosis factor receptor superfamily member 3 (Lymphotoxin-beta receptor) (Tumor necrosis factor C receptor) (Tumor necrosis factor receptor 2-related protein) (Tumor necrosis factor receptor type III) (TNF-RIII) (TNFR-III)

Protein function

Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT (PubMed:24248355). Activates NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA(1)-LTB(2)) (PubMed:24248355). Promotes apoptosis via TRAF3

PDB

1RF3 , 4MXW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	43 → 80	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	83 → 124	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	163 → 210	TNFR/NGFR cysteine-rich region	Domain

Sequence

MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCS
RCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKR
KTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS
PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLL
ATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD
VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGN
IYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA
TPSNRGPRNQFITHD

Sequence length

435

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor NF-kappa B signaling pathway HIF-1 signaling pathway Intestinal immune network for IgA production Human T-cell leukemia virus 1 infection Viral carcinogenesis		TNFR2 non-canonical NF-kB pathway TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Malignant tumor of urinary bladder	Benign	rs147770937	RCV005906472

Show/Hide Text Mining Associations (41)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	8798772
Arthritis Rheumatoid	Associate	18353171, 30159339
Asthma	Associate	23804543
Autoimmune Diseases	Associate	26782510, 30159339
Breast Neoplasms	Associate	26317411
Carcinoma Hepatocellular	Associate	37366426
Celiac Disease	Associate	31591516
Colorectal Neoplasms	Associate	34541005
Cystitis	Stimulate	25369740
Death	Associate	22640629
Delirium	Associate	37156856
Dental Plaque	Associate	35535576
Drug Related Side Effects and Adverse Reactions	Associate	9371602, 9739048
Eosinophilic Esophagitis	Associate	32712105
Granuloma	Associate	12000723
Granulomatous Disease Chronic	Associate	12000723
Head and Neck Neoplasms	Associate	30488488
Immunologic Deficiency Syndromes	Associate	12176893
Infections	Associate	10391855
Inflammation	Associate	20592286, 26782510, 29369166, 30159339, 33148272, 37229810
Inflammation	Stimulate	31878945
Leukemia	Associate	37951201
Leukemia Myeloid Acute	Associate	11264180
Lung Neoplasms	Associate	9817170
Lupus Erythematosus Systemic	Associate	30159339
Lymphatic Metastasis	Associate	25369740
Lymphoma Non Hodgkin	Associate	11092613
Lymphoma T Cell	Associate	22640629
Melanoma	Associate	18347013
Microsatellite Instability	Associate	38175686
Multiple Myeloma	Associate	17692805
Multiple Sclerosis	Associate	30479356
Neoplasms	Associate	10799510, 19701890, 38175686, 9739048
Osteosarcoma	Associate	10849374
Prostatic Hyperplasia	Associate	26782510
Reflex Sympathetic Dystrophy	Associate	19380284
Sjogren's Syndrome	Associate	30159339
Spondylitis Ankylosing	Associate	21743469
Squamous Cell Carcinoma of Head and Neck	Associate	30488488
Status Asthmaticus	Associate	24782592
Urinary Bladder Neoplasms	Stimulate	25369740

LTBR (lymphotoxin beta receptor)