Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4047
Gene name Gene Name - the full gene name approved by the HGNC.
Lanosterol synthase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LSS
Synonyms (NCBI Gene) Gene synonyms aliases
APMR4, CTRCT44, HYPT14, OSC
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and v
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs749141857 A>C,G Pathogenic Missense variant, coding sequence variant
rs754230211 T>A,C Pathogenic Missense variant, coding sequence variant
rs1249530918 A>G Pathogenic Coding sequence variant, missense variant
rs1260995701 A>G Pathogenic Coding sequence variant, missense variant
rs1569036540 C>T Pathogenic Intron variant, stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018611 hsa-miR-335-5p Microarray 18185580
MIRT028552 hsa-miR-30a-5p Proteomics 18668040
MIRT047714 hsa-miR-10a-5p CLASH 23622248
MIRT047498 hsa-miR-10b-5p CLASH 23622248
MIRT045991 hsa-miR-125b-5p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
HDAC3 Unknown 17925399
YY1 Unknown 17925399
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000250 Function Lanosterol synthase activity IBA
GO:0000250 Function Lanosterol synthase activity IEA
GO:0000250 Function Lanosterol synthase activity IGI 7639730
GO:0000250 Function Lanosterol synthase activity IMP 26200341
GO:0000250 Function Lanosterol synthase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600909 6708 ENSG00000160285
Protein
UniProt ID P48449
Protein name Lanosterol synthase (EC 5.4.99.7) (2,3-epoxysqualene--lanosterol cyclase) (Oxidosqualene--lanosterol cyclase) (OSC) (hOSC)
Protein function Key enzyme in the cholesterol biosynthesis pathway. Catalyzes the cyclization of (S)-2,3 oxidosqualene to lanosterol, a reaction that forms the sterol nucleus (PubMed:14766201, PubMed:26200341, PubMed:7639730). Through the production of lanoster
PDB 1W6J , 1W6K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00432 Prenyltrans 122 165 Prenyltransferase and squalene oxidase repeat Repeat
PF00432 Prenyltrans 557 600 Prenyltransferase and squalene oxidase repeat Repeat
PF00432 Prenyltrans 610 658 Prenyltransferase and squalene oxidase repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in the hair bulb, the outer root sheath and hair matrix of the hair follicle epithelium. Also detected in dermal papilla, epidermis, sweat glands, sebaceous glands, and blood vessels. {ECO:0000269|PubMed:304
Sequence
MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDT
KNYFKDLPKAHTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLP
AGYREEIVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNIL
HKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWAPAHPSTLWCHCRQVYLPM
SYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNVAPDELYTPHSWLLRVVYALL
NLYEHHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYVDGPASTAFQE
HVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRL
SQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPR
ERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQA
LKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMG
QTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYLQSAQSQIHNTCWAMMGLM
AVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFS
QLYPERALAGHP
Sequence length 732
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Steroid biosynthesis
Metabolic pathways
  Cholesterol biosynthesis
Activation of gene expression by SREBF (SREBP)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Alopecia-mental retardation syndrome Alopecia-intellectual disability syndrome 4 rs570157673, rs763705074, rs1569039353, rs1569036540, rs754230211, rs746562872 N/A
Cataract cataract 44 rs864622780, rs749141857, rs764098604 N/A
Hypotrichosis hypotrichosis 14 rs1249530918, rs1260995701, rs1569039353 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alopecia autosomal recessive palmoplantar keratoderma and congenital alopecia N/A N/A GenCC
Hypotrichosis simplex hypotrichosis simplex N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 30660405
Alopecia Associate 37947113
AMR Syndrome Associate 30723320
Aphasia Associate 35830358
Basaran Yilmaz syndrome Associate 35413293
Carcinoma Hepatocellular Associate 25855471
Cardiovascular Diseases Associate 31760884
Cataract Associate 30723320, 35413293, 36272497, 37947113
Chromosome 21 monosomy Associate 35361402
Chromosome 21 ring Associate 35361402