Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3932
Gene name Gene Name - the full gene name approved by the HGNC.	LCK proto-oncogene, Src family tyrosine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LCK
Synonyms (NCBI Gene) Gene synonyms aliases	IMD22, LSK, YT16, p56lck, pp58lck
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IMD22
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p35.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK doma

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777335	T>C	Pathogenic	Coding sequence variant, missense variant
rs1569967422	->A	Likely-pathogenic	Frameshift variant, coding sequence variant

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017673	hsa-miR-335-5p	Microarray	18185580
MIRT2029138	hsa-miR-1197	CLIP-seq
MIRT2029139	hsa-miR-4436a	CLIP-seq
MIRT2029140	hsa-miR-4700-3p	CLIP-seq
MIRT2029138	hsa-miR-1197	CLIP-seq
MIRT2029139	hsa-miR-4436a	CLIP-seq
MIRT2029140	hsa-miR-4700-3p	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
ETS1	Activation	7970721
ETS2	Activation	7970721
MYB	Activation	7970721

Show/Hide all(55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000242	Component	Pericentriolar material	IDA	7513706
GO:0001772	Component	Immunological synapse	IDA	20007709
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1381360, 9799234, 12923167, 18697750
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	IDA	214242
GO:0004713	Function	Protein tyrosine kinase activity	IMP	8681956
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0004722	Function	Protein serine/threonine phosphatase activity	IDA	8506364
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	7507203, 7513706, 7852312, 8114715, 8576115, 8650207, 8798676, 9045636, 9175835, 9341123, 10209036, 10318843, 10369126, 10553045, 10656681, 11278465, 11741929, 11978774, 14625311, 14757743, 15536084, 15554700, 15827961, 16051843, 16099425, 16107303, 16195219, 16245368, 16461343, 1683
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	12150984
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	IDA	214242
GO:0006470	Process	Protein dephosphorylation	IEA
GO:0006882	Process	Cellular zinc ion homeostasis	IEP	11739864
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	16116473
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0008022	Function	Protein C-terminus binding	IPI	16245368
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IMP	8681956
GO:0019901	Function	Protein kinase binding	IPI	8618896
GO:0019903	Function	Protein phosphatase binding	IPI	22080863, 24714587
GO:0030097	Process	Hemopoiesis	NAS	12884910
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030168	Process	Platelet activation	TAS
GO:0030217	Process	T cell differentiation	IBA	21873635
GO:0030217	Process	T cell differentiation	IMP	1579166
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031295	Process	T cell costimulation	TAS
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IMP	27400149
GO:0042169	Function	SH2 domain binding	IPI	7852312, 8794306
GO:0042493	Process	Response to drug	IDA	16116473
GO:0042608	Function	T cell receptor binding	IPI	8681956
GO:0042609	Function	CD4 receptor binding	IPI	7486703
GO:0042610	Function	CD8 receptor binding	IPI	2470098
GO:0042802	Function	Identical protein binding	IPI	17118402, 24463463
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IPI	7504174
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045121	Component	Membrane raft	IDA	12150984, 12732664
GO:0050690	Process	Regulation of defense response to virus by virus	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050853	Process	B cell receptor signaling pathway	IBA	21873635
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	NAS	12614355
GO:0050870	Process	Positive regulation of T cell activation	IDA	8943371
GO:0050900	Process	Leukocyte migration	TAS
GO:0051117	Function	ATPase binding	IPI	15671290
GO:0051209	Process	Release of sequestered calcium ion into cytosol	ISS
GO:0051249	Process	Regulation of lymphocyte activation	NAS	7852312
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:1903039	Process	Positive regulation of leukocyte cell-cell adhesion	IMP	27400149
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	16116473

MIM	HGNC	e!Ensembl
153390	6524	ENSG00000182866

Protein

UniProt ID

P06239

Protein name

Tyrosine-protein kinase Lck (EC 2.7.10.2) (Leukocyte C-terminal Src kinase) (LSK) (Lymphocyte cell-specific protein-tyrosine kinase) (Protein YT16) (Proto-oncogene Lck) (T cell-specific protein-tyrosine kinase) (p56-LCK)

Protein function

Non-receptor tyrosine-protein kinase that plays an essential role in the selection and maturation of developing T-cells in the thymus and in the function of mature T-cells. Plays a key role in T-cell antigen receptor (TCR)-linked signal transduc

PDB

1BHF , 1BHH , 1CWD , 1CWE , 1FBZ , 1H92 , 1IJR , 1KIK , 1LCJ , 1LCK , 1LKK , 1LKL , 1Q68 , 1Q69 , 1QPC , 1QPD , 1QPE , 1QPJ , 1X27 , 2IIM , 2OF2 , 2OF4 , 2OFU , 2OFV , 2OG8 , 2PL0 , 2ZM1 , 2ZM4 , 2ZYB , 3AC1 , 3AC2 , 3AC3 , 3AC4 , 3AC5 , 3AC8 , 3ACJ , 3ACK , 3AD4 , 3AD5 , 3AD6 , 3B2W , 3BRH , 3BYM , 3BYO , 3BYS , 3BYU , 3KMM , 3KXZ , 3LCK , 3MPM , 4C3F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	67 → 113	SH3 domain	Domain
PF00017	SH2	127 → 209	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	245 → 494	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed specifically in lymphoid cells.

Sequence

MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP

Sequence length

509

Interactions

View interactions

	KEGG		Reactome
	NF-kappa B signaling pathway Osteoclast differentiation Natural killer cell mediated cytotoxicity Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway Yersinia infection Human T-cell leukemia virus 1 infection PD-L1 expression and PD-1 checkpoint pathway in cancer Primary immunodeficiency		GPVI-mediated activation cascade PIP3 activates AKT signaling Signaling by SCF-KIT Regulation of KIT signaling Nef and signal transduction Nef Mediated CD4 Down-regulation Downstream TCR signaling Phosphorylation of CD3 and TCR zeta chains Translocation of ZAP-70 to Immunological synapse Generation of second messenger molecules PECAM1 interactions Constitutive Signaling by Aberrant PI3K in Cancer DAP12 signaling CD28 co-stimulation CD28 dependent PI3K/Akt signaling CD28 dependent Vav1 pathway CTLA4 inhibitory signaling PD-1 signaling PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Interleukin-2 signaling

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Immunodeficiency	IMMUNODEFICIENCY 22	rs1565678077, rs121908002, rs1421444086, rs1565688667, rs944235493, rs121918314, rs587776713, rs137852678, rs587776714, rs128620188, rs2147483647, rs1569556522, rs137853331, rs137853332, rs179363866 View all (256 more)	11351273, 22985903
Severe combined immunodeficiency disease	Combined immunodeficiency, Severe combined immunodeficiency due to LCK deficiency	rs886037607, rs118203993, rs121908714, rs121908739, rs121908740, rs121908735, rs121908721, rs121908722, rs121908156, rs1564414523, rs1564418254, rs1564446526, rs786205074, rs121908157, rs121908159 View all (197 more)	11351273

Show/Hide Text Mining Associations (94)

Disease Name	Relationship Type	References
Associations from Text Mining
Acquired Immunodeficiency Syndrome	Inhibit	8823293
Alopecia Areata	Associate	20546884
Anodontia	Associate	14534291
Aortic Aneurysm Abdominal	Stimulate	33858751
Arthritis Rheumatoid	Associate	32840301, 33430905
Breast Neoplasms	Associate	14699120, 23558942, 26126114, 31715586, 32710281
Carcinoma Endometrioid	Associate	33159014
Carcinoma Hepatocellular	Associate	24564241, 32730361, 34218795
Carcinoma Non Small Cell Lung	Associate	17202451, 22457183
Carcinoma Pancreatic Ductal	Associate	33213062
Carcinoma Renal Cell	Associate	31672930, 40612864
Cardiomyopathy Dilated	Associate	36733486
Carotid Artery Diseases	Associate	36316672
Cerebral Hemorrhage	Associate	30836997, 33206327
Cholangiocarcinoma	Associate	36162702
Chromosome Breakage	Associate	8049439
Colitis Ulcerative	Stimulate	9329971
Colonic Neoplasms	Associate	29562499, 7499213
Colorectal Neoplasms	Associate	11180095, 9490199
Coronary Artery Disease	Associate	30015926
COVID 19	Associate	34330510
Craniopharyngioma	Associate	25990246
Crohn Disease	Stimulate	9329971
Death	Associate	24688028
Diabetic Nephropathies	Stimulate	36568106
Drug Related Side Effects and Adverse Reactions	Associate	30333226
Endometrial Neoplasms	Associate	33159014
Fibromatosis Aggressive	Associate	9736021
Fibrosis	Associate	21824427
Glioblastoma	Associate	32237064, 34395626
Hashimoto Disease	Associate	34522174
Head and Neck Neoplasms	Associate	35090306
Hematologic Neoplasms	Associate	36430477
HIV Infections	Associate	12823281
HIV Infections	Inhibit	8823293
Hodgkin Disease	Inhibit	16304050
Hypoxia	Associate	14534291
Hypoxia Brain	Associate	35150959
Idiopathic Pulmonary Fibrosis	Associate	24089408
Infections	Associate	12823281, 21345943
Inflammation	Associate	33858751, 33999861, 37426642
Inflammatory Bowel Diseases	Associate	9329971
Leprosy	Associate	15967991
Leukemia	Associate	1530879, 8611704
Leukemia Lymphocytic Chronic B Cell	Associate	23505068, 29669754, 9558397
Leukemia Prolymphocytic T Cell	Associate	29196709
Leukemia T Cell	Associate	1379847, 1680958, 26210498
Lown Ganong Levine Syndrome	Associate	32710281
Lung Diseases	Associate	17078813
Lung Neoplasms	Associate	24135919
Lupus Erythematosus Systemic	Inhibit	11681490, 12746907, 15085197, 17082661
Lupus Erythematosus Systemic	Associate	19201859, 37426642
Lymphoma	Associate	2779553
Lymphoma	Stimulate	32237064
Lymphoma Follicular	Associate	20208138
Lymphoma Large B Cell Diffuse	Associate	32237064
Lymphoma Large Cell Anaplastic	Associate	20511667
Lymphoma T Cell Peripheral	Associate	23716562
Lymphoproliferative Disorders	Inhibit	24688028
Melanoma	Associate	27335052
Melanoma	Stimulate	36341345
Mitochondrial Diseases	Associate	26210498
Mouth Neoplasms	Associate	34116687
Multiple Myeloma	Inhibit	14717778
Mycosis Fungoides	Associate	10903801, 25779945
Myositis Inclusion Body	Associate	35237874
Nasopharyngeal Carcinoma	Associate	37274867
Neoplasm Metastasis	Associate	11180095, 34116687
Neoplasms	Associate	10478643, 11180095, 1680958, 19272155, 19435912, 22457183, 24155921, 24231767, 26210498, 27335052, 2779553, 28936799, 31515669, 31715586, 31817155 View all (8 more)
Neoplasms	Inhibit	34218795
Neuroinflammatory Diseases	Associate	30836997
Nose Diseases	Inhibit	22310933
Obesity	Stimulate	34330510
Obesity	Associate	37063877
Ovarian Neoplasms	Associate	31515669, 37773310
Pancreatic Neoplasms	Associate	33213062
Paraparesis Tropical Spastic	Stimulate	26358743
Paraparesis Tropical Spastic	Associate	40004169
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	16467082, 37363966
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	1680958, 23872305, 35805156, 8049439
Primary Ovarian Insufficiency	Associate	37460774
Prostatic Neoplasms	Associate	29938870, 31253147
Prostatitis	Associate	8650201
Pulmonary Disease Chronic Obstructive	Associate	23977094, 33108241
Sarcoidosis	Inhibit	21177920
Sarcoidosis	Associate	24284293
Schizophrenia	Associate	24564241
Scleroderma Systemic	Associate	35663995
Severe Combined Immunodeficiency	Associate	9664084
Sezary Syndrome	Associate	25779945
Urinary Bladder Neoplasms	Associate	32228629, 33204728
Uterine Cervical Neoplasms	Associate	35090306
Uveomeningoencephalitic Syndrome	Associate	35003060
X Linked Combined Immunodeficiency Diseases	Associate	38112969

LCK (LCK proto-oncogene, Src family tyrosine kinase)